MICA Protein, Cynomolgus (HEK293, His)
Based on 1 Customer Validation
MICA Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived MICA, expressed by HEK293 , with C-His labeled tag. ,
- Species: Cynomolgus
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
MICA Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived MICA, expressed by HEK293 , with C-His labeled tag. ,
Background
MICA is an MHC class I chain-associated protein and a ligand for the stress signaling protein and natural killer (NK) cell-activating receptor KLRK1/NKG2D. MICA serves as a stress-induced autoantigen recognized by γδ T cells. Tumor cells escape by shedding overexpressed MICA, disrupting the biological function of NKG2D. CRC patients with high MICA expression have poor prognosis. In patients with head and neck squamous cell carcinoma (HNSCC) receiving curative chemoradiotherapy (CRT), persistently elevated levels of soluble MICA-related sequences and TGF-β1 mark a higher risk of tumor progression or death.
Verified Bioactivity
Immobilized Human NKG2D Protein at 5 μg/mL (100 μL/well) can bind Cynomolgus MICA Protein. The ED50 for this effect is 0.3073 μg/mL.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - ELISA
Bioactivity - ELISA
Technical Parameters
-
Species Cynomolgus
-
Source HEK293
-
Tag C-His
-
Accession
AAO24115 (E1-P288)
-
Molecular Construction
-
N-term
-
MICA (E1-P288)
Accession # AAO24115 -
His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
MICA; MHC Class I Related Chain A Isoform B1; MHC Class I Polypeptide-Related Sequence A; MHC Class I Related Chain A Isoform B2; PERB11.1; MHC Class I Related Chain A Isoform C; Major Histocompatibility Complex Class I Chain-Related Protein A; MHC Class
-
AA Sequence
ELHSLRYNVTVLSRDGSVQSEFLAEGHLDGQLFVRYDRETRRARPQGQWAEDVLGAKTWDTETGDLTENGKDLRMTLAHIKGQKGGLHSLQEIKVCEIHEDNSTGGLRHFYYDGELFLSQNLETQEWTELQSSRAQTLALNIRNFWKEDTMKTKTHYRAVQADCLKKLQRYLESGVAVRRTAPPMVNVTHSEASEGNITVTCRASGFYPRNIALTWRQDGVSLNHNAQQWGGILPDQNGTYQTWVATRIRQGEEQRFACYMEHSGNHSTHPVPSGKVLVFQSQWLDIP
-
Molecular Weight
Approximately 40-55 kDa
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (254 KB)
- English - EN (254 KB)
- Français - FR (254 KB)
- Deutsch - DE (254 KB)
- Norwegian - NO (254 KB)
- Español - ES (254 KB)
- Swedish - SV (254 KB)
- Italian - IT (254 KB)
- Korean - KR (254 KB)
- Portuguese - PT (254 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
