MICA Protein, Cynomolgus (HEK293, His)

MICA Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived MICA, expressed by HEK293 , with C-His labeled tag. ,

MICA is an MHC class I chain-associated protein and a ligand for the stress signaling protein and natural killer (NK) cell-activating receptor KLRK1/NKG2D. MICA serves as a stress-induced autoantigen recognized by γδ T cells. Tumor cells escape by shedding overexpressed MICA, disrupting the biological function of NKG2D. CRC patients with high MICA expression have poor prognosis. In patients with head and neck squamous cell carcinoma (HNSCC) receiving curative chemoradiotherapy (CRT), persistently elevated levels of soluble MICA-related sequences and TGF-β1 mark a higher risk of tumor progression or death.

Immobilized Human NKG2D Protein at 5 μg/mL (100 μL/well) can bind Cynomolgus MICA Protein. The ED₅₀ for this effect is 0.3073 μg/mL.

• 
  Immobilized Human NKG2D Protein at 5 μg/mL (100 μL/well) can bind Cynomolgus MICA Protein. The ED₅₀ for this effect is 0.3073 μg/mL.

Cynomolgus

HEK293

C-His

AAO24115 (E1-P288)

123572792  [NCBI]

Partial

ELHSLRYNVTVLSRDGSVQSEFLAEGHLDGQLFVRYDRETRRARPQGQWAEDVLGAKTWDTETGDLTENGKDLRMTLAHIKGQKGGLHSLQEIKVCEIHEDNSTGGLRHFYYDGELFLSQNLETQEWTELQSSRAQTLALNIRNFWKEDTMKTKTHYRAVQADCLKKLQRYLESGVAVRRTAPPMVNVTHSEASEGNITVTCRASGFYPRNIALTWRQDGVSLNHNAQQWGGILPDQNGTYQTWVATRIRQGEEQRFACYMEHSGNHSTHPVPSGKVLVFQSQWLDIP

Approximately 40-55 kDa

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.