MINPP1 Protein, Human (P.pastoris, His)

The MINPP1 protein is a bifunctional phosphatase that regulates inositol pentaphosphate (InsP5) and phytate hexaphosphate (InsP6) levels through phosphoinositide 5- and phosphoinositide 6-phosphatase activities. It also acts as 2,3-bisphosphoglycerate 3-phosphatase, which is essential for bone development and chondrocyte transformation. MINPP1 Protein, Human (P.pastoris, His) is the recombinant human-derived MINPP1 protein, expressed by P. pastoris , with N-His labeled tag.

MINPP1 Protein acts as a dual-function phosphatase, exhibiting phosphoinositide 5- and phosphoinositide 6-phosphatase activity to regulate cellular levels of inositol pentakisphosphate (InsP5) and inositol hexakisphosphate (InsP6). Additionally, it functions as a 2,3-bisphosphoglycerate 3-phosphatase, catalyzing the dephosphorylation of 2,3-bisphosphoglycerate (2,3-BPG) to produce phospho-D-glycerate without the formation of 3-phosphoglycerate. These activities are crucial for cellular processes, including bone development, specifically in endochondral ossification, and may contribute to the transition of chondrocytes from proliferation to hypertrophy. By regulating intracellular inositol polyphosphates, MINPP1 plays a potential role in controlling intracellular cation homeostasis, impacting free cation availability required for neural cell signaling.

Human

P. pastoris

N-His

Q9UNW1 (S31-L487)

9562  [NCBI]

Full Length of Mature Protein

SLLEPRDPVASSLSPYFGTKTRYEDVNPVLLSGPEAPWRDPELLEGTCTPVQLVALIRHGTRYPTVKQIRKLRQLHGLLQARGSRDGGASSTGSRDLGAALADWPLWYADWMDGQLVEKGRQDMRQLALRLASLFPALFSRENYGRLRLITSSKHRCMDSSAAFLQGLWQHYHPGLPPPDVADMEFGPPTVNDKLMRFFDHCEKFLTEVEKNATALYHVEAFKTGPEMQNILKKVAATLQVPVNDLNADLIQVAFFTCSFDLAIKGVKSPWCDVFDIDDAKVLEYLNDLKQYWKRGYGYTINSRSSCTLFQDIFQHLDKAVEQKQRSQPISSPVILQFGHAETLLPLLSLMGYFKDKEPLTAYNYKKQMHRKFRSGLIVPYASNLIFVLYHCENAKTPKEQFRVQMLLNEKVLPLAYSQETVSFYEDLKNHYKDILQSCQTSEECELARANSTSDEL

≥ 90%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.