MINPP1 Protein, Human (P.pastoris, His)
The MINPP1 protein is a bifunctional phosphatase that regulates inositol pentaphosphate (InsP5) and phytate hexaphosphate (InsP6) levels through phosphoinositide 5- and phosphoinositide 6-phosphatase activities. It also acts as 2,3-bisphosphoglycerate 3-phosphatase, which is essential for bone development and chondrocyte transformation. MINPP1 Protein, Human (P.pastoris, His) is the recombinant human-derived MINPP1 protein, expressed by P. pastoris , with N-His labeled tag.
- Species: Human
- Source: P. pastoris
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The MINPP1 protein is a bifunctional phosphatase that regulates inositol pentaphosphate (InsP5) and phytate hexaphosphate (InsP6) levels through phosphoinositide 5- and phosphoinositide 6-phosphatase activities. It also acts as 2,3-bisphosphoglycerate 3-phosphatase, which is essential for bone development and chondrocyte transformation. MINPP1 Protein, Human (P.pastoris, His) is the recombinant human-derived MINPP1 protein, expressed by P. pastoris , with N-His labeled tag.
Background
MINPP1 Protein acts as a dual-function phosphatase, exhibiting phosphoinositide 5- and phosphoinositide 6-phosphatase activity to regulate cellular levels of inositol pentakisphosphate (InsP5) and inositol hexakisphosphate (InsP6). Additionally, it functions as a 2,3-bisphosphoglycerate 3-phosphatase, catalyzing the dephosphorylation of 2,3-bisphosphoglycerate (2,3-BPG) to produce phospho-D-glycerate without the formation of 3-phosphoglycerate. These activities are crucial for cellular processes, including bone development, specifically in endochondral ossification, and may contribute to the transition of chondrocytes from proliferation to hypertrophy. By regulating intracellular inositol polyphosphates, MINPP1 plays a potential role in controlling intracellular cation homeostasis, impacting free cation availability required for neural cell signaling.
Technical Parameters
-
Species Human
-
Source P. pastoris
-
Tag N-His
-
Accession
Q9UNW1 (S31-L487)
-
Molecular Construction
-
N-term
-
His
-
MINPP1 (S31-L487)
Accession # Q9UNW1 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
MINPP1; Inositol (1,3,4,5)-Tetrakisphosphate 3-Phosphatase; Multiple Inositol-Polyphosphate Phosphatase 1; Multiple Inositol Polyphosphate Phosphatase 2; MIPP; Ins(1,3,4,5)P(4) 3-Phosphatase; Multiple Inositol Polyphosphate Histidine Phosphatase, 1; HIPER
-
AA Sequence
SLLEPRDPVASSLSPYFGTKTRYEDVNPVLLSGPEAPWRDPELLEGTCTPVQLVALIRHGTRYPTVKQIRKLRQLHGLLQARGSRDGGASSTGSRDLGAALADWPLWYADWMDGQLVEKGRQDMRQLALRLASLFPALFSRENYGRLRLITSSKHRCMDSSAAFLQGLWQHYHPGLPPPDVADMEFGPPTVNDKLMRFFDHCEKFLTEVEKNATALYHVEAFKTGPEMQNILKKVAATLQVPVNDLNADLIQVAFFTCSFDLAIKGVKSPWCDVFDIDDAKVLEYLNDLKQYWKRGYGYTINSRSSCTLFQDIFQHLDKAVEQKQRSQPISSPVILQFGHAETLLPLLSLMGYFKDKEPLTAYNYKKQMHRKFRSGLIVPYASNLIFVLYHCENAKTPKEQFRVQMLLNEKVLPLAYSQETVSFYEDLKNHYKDILQSCQTSEECELARANSTSDEL
-
Predicted Molecular Mass
54.1 kDa
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
