MIP-3 alpha/CCL20 Protein, Bovine (His-SUMO)

The MIP-3 α/CCL20 protein acts as a ligand for CCR6, inducing an efficient chemotactic response and intracellular calcium mobilization upon CCR6 binding. The CCL20-CCR6 pair is critical in chemotaxis, attracting dendritic cells, effector/memory T cells, and B cells, especially to skin and mucosal surfaces during homeostasis, inflammation, cancer, and autoimmune diseases. MIP-3 alpha/CCL20 Protein, Bovine (His-SUMO) is the recombinant bovine-derived MIP-3 alpha/CCL20 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Bovine
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The MIP-3 α/CCL20 protein acts as a ligand for CCR6, inducing an efficient chemotactic response and intracellular calcium mobilization upon CCR6 binding. The CCL20-CCR6 pair is critical in chemotaxis, attracting dendritic cells, effector/memory T cells, and B cells, especially to skin and mucosal surfaces during homeostasis, inflammation, cancer, and autoimmune diseases. MIP-3 alpha/CCL20 Protein, Bovine (His-SUMO) is the recombinant bovine-derived MIP-3 alpha/CCL20 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Background

MIP-3 alpha/CCL20 Protein serves as a ligand for C-C chemokine receptor CCR6, initiating a potent chemotactic response and mobilizing intracellular calcium ions upon CCR6 binding and activation. The CCL20-CCR6 ligand-receptor pair plays a crucial role in chemotaxis, attracting dendritic cells (DC), effector/memory T-cells, and B-cells. This partnership is particularly significant in skin and mucosal surfaces under various conditions, including homeostasis, inflammation, cancer, and autoimmune diseases. Acting as a chemotactic factor, CCL20 specifically attracts lymphocytes and, to a lesser extent, neutrophils, excluding monocytes. Furthermore, it is involved in recruiting both pro-inflammatory IL17-producing helper T-cells (Th17) and regulatory T-cells (Treg) to inflammation sites. CCL20 is essential for the optimal migration of thymic natural regulatory T cells (nTregs) and DN1 early thymocyte progenitor cells. Additionally, it positively regulates sperm motility and chemotaxis by binding to CCR6, triggering Ca2+ mobilization in sperm, a crucial factor for motility. CCL20 may also contribute to the formation and function of mucosal lymphoid tissues by directing lymphocytes and dendritic cells towards epithelial cells.

Technical Parameters

  • Species Bovine
  • Source E. coli
  • Tag N-SUMO;N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His-SUMO
    • CCL20 (A27-M96)
      Accession # Q8SQB1
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    CCL20; Chemokine (C-C Motif) Ligand 20; Prev. SCYA20; C-C Motif Chemokine 20; LARC; CC Chemokine LARC; MIP-3a; MIP-3-Alpha; ST38; Exodus-1; CKb4; MIP3A; Small Inducible Cytokine Subfamily A (Cys-Cys), Member 20; Beta Chemokine Exodus-1; Liver And Activati

  • AA Sequence

    ASNFDCCLRYTERILHPSILVGFTQQLANEACDINAVVFYTRKKLAVCADPKKKWVKQVVHMLSQRVKRM

  • Predicted Molecular Mass

    24.1 kDa

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00