MIP-3 alpha/CCL20 Protein, Bovine (His-SUMO)
The MIP-3 α/CCL20 protein acts as a ligand for CCR6, inducing an efficient chemotactic response and intracellular calcium mobilization upon CCR6 binding. The CCL20-CCR6 pair is critical in chemotaxis, attracting dendritic cells, effector/memory T cells, and B cells, especially to skin and mucosal surfaces during homeostasis, inflammation, cancer, and autoimmune diseases. MIP-3 alpha/CCL20 Protein, Bovine (His-SUMO) is the recombinant bovine-derived MIP-3 alpha/CCL20 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.
- Species: Bovine
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The MIP-3 α/CCL20 protein acts as a ligand for CCR6, inducing an efficient chemotactic response and intracellular calcium mobilization upon CCR6 binding. The CCL20-CCR6 pair is critical in chemotaxis, attracting dendritic cells, effector/memory T cells, and B cells, especially to skin and mucosal surfaces during homeostasis, inflammation, cancer, and autoimmune diseases. MIP-3 alpha/CCL20 Protein, Bovine (His-SUMO) is the recombinant bovine-derived MIP-3 alpha/CCL20 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.
Background
MIP-3 alpha/CCL20 Protein serves as a ligand for C-C chemokine receptor CCR6, initiating a potent chemotactic response and mobilizing intracellular calcium ions upon CCR6 binding and activation. The CCL20-CCR6 ligand-receptor pair plays a crucial role in chemotaxis, attracting dendritic cells (DC), effector/memory T-cells, and B-cells. This partnership is particularly significant in skin and mucosal surfaces under various conditions, including homeostasis, inflammation, cancer, and autoimmune diseases. Acting as a chemotactic factor, CCL20 specifically attracts lymphocytes and, to a lesser extent, neutrophils, excluding monocytes. Furthermore, it is involved in recruiting both pro-inflammatory IL17-producing helper T-cells (Th17) and regulatory T-cells (Treg) to inflammation sites. CCL20 is essential for the optimal migration of thymic natural regulatory T cells (nTregs) and DN1 early thymocyte progenitor cells. Additionally, it positively regulates sperm motility and chemotaxis by binding to CCR6, triggering Ca2+ mobilization in sperm, a crucial factor for motility. CCL20 may also contribute to the formation and function of mucosal lymphoid tissues by directing lymphocytes and dendritic cells towards epithelial cells.
Technical Parameters
-
Species Bovine
-
Source E. coli
-
Tag N-SUMO;N-6*His
-
Accession
Q8SQB1 (A27-M96)
-
Molecular Construction
-
N-term
-
6*His-SUMO
-
CCL20 (A27-M96)
Accession # Q8SQB1 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
CCL20; Chemokine (C-C Motif) Ligand 20; Prev. SCYA20; C-C Motif Chemokine 20; LARC; CC Chemokine LARC; MIP-3a; MIP-3-Alpha; ST38; Exodus-1; CKb4; MIP3A; Small Inducible Cytokine Subfamily A (Cys-Cys), Member 20; Beta Chemokine Exodus-1; Liver And Activati
-
AA Sequence
ASNFDCCLRYTERILHPSILVGFTQQLANEACDINAVVFYTRKKLAVCADPKKKWVKQVVHMLSQRVKRM
-
Predicted Molecular Mass
24.1 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)