MSRB3 Protein, Human (HEK293, Fc)
MSRB3 Protein, with a unique ability to catalyze methionine sulfoxide reduction, plays a crucial role in the auditory system. Isoform 2 of MSRB3 is deemed essential for normal hearing, highlighting its significance in auditory function. MSRB3 Protein, Human (HEK293, Fc) is the recombinant human-derived MSRB3 protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
MSRB3 Protein, with a unique ability to catalyze methionine sulfoxide reduction, plays a crucial role in the auditory system. Isoform 2 of MSRB3 is deemed essential for normal hearing, highlighting its significance in auditory function. MSRB3 Protein, Human (HEK293, Fc) is the recombinant human-derived MSRB3 protein, expressed by HEK293 , with C-hFc labeled tag.
Background
MSRB3, a protein with the distinctive ability to catalyze the reduction of both free and protein-bound methionine sulfoxide to methionine, stands out for its crucial role in the auditory system. Specifically, isoform 2 of MSRB3 is deemed essential for normal hearing, underscoring its significance in auditory function.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-hFc
-
Accession
Q8IXL7-2 (G26-D181)
-
Molecular Construction
-
N-term
-
MSRB3 (G26-D181)
Accession # Q8IXL7-2 -
hFc
-
C-term
-
-
Protein Length
Partial
-
Synonyms
MSRB3; Methionine-R-Sulfoxide Reductase B3, Mitochondrial; Prev. DFNB74; L-Methionine (R)-S-Oxide Reductase; Methionine-R-Sulfoxide Reductase B3; Deafness, Autosomal Recessive 74; DKFZp686C1178; MsrB3; FLJ36866; Methionine Sulfoxide Reductase B3; Peptide-
-
AA Sequence
GSCRDKKNCKVVFSQQELRKRLTPLQYHVTQEKGTESAFEGEYTHHKDPGIYKCVVCGTPLFKSETKFDSGSGWPSFHDVINSEAITFTDDFSYGMHRVETSCSQCGAHLGHIFDDGPRPTGKRYCINSAALSFTPADSSGTAEGGSGVASPAQAD
-
Predicted Molecular Mass
43.7 kDa
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
