NDRG1 Protein, Human (His)
Based on 1 Customer Validation
NDRG1 is a stress-responsive protein and an important tumor suppressor involved in hormone response and cell growth. It aids in Schwann cell transport, which is essential for the development of myelin in peripheral nerves. NDRG1 Protein, Human (His) is the recombinant human-derived NDRG1 protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
NDRG1 is a stress-responsive protein and an important tumor suppressor involved in hormone response and cell growth. It aids in Schwann cell transport, which is essential for the development of myelin in peripheral nerves. NDRG1 Protein, Human (His) is the recombinant human-derived NDRG1 protein, expressed by E. coli , with N-6*His labeled tag.
NDRG1, a stress-responsive protein, plays a crucial role in hormone responses, cell growth, and differentiation, functioning as a tumor suppressor in various cell types. While necessary for p53/TP53-mediated caspase activation and apoptosis, it alone is not sufficient for these processes. NDRG1 contributes to cell trafficking, particularly in Schwann cells, and is essential for the maintenance and development of the peripheral nerve myelin sheath. Additionally, it is required for the vesicular recycling of CDH1 and TF and may participate in lipid trafficking. Notably, NDRG1 shields cells from spindle disruption damage and functions in the p53/TP53-dependent mitotic spindle checkpoint, regulating microtubule dynamics and preserving euploidy. Its interaction with membrane-bound RAB4A is integral to vesicular recycling of CDH1, further emphasizing its diverse roles in cellular processes.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
Q92597 (M1-C394)
-
Molecular Construction
-
N-term
-
6*His
-
NDRG1 (M1-C394)
Accession # Q92597 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
NDRG1; Protein NDRG1; Prev. CAP43; Protein Regulated By Oxygen-1; DRG1; PROXY1; RTP; CMT4D; TDD5; HMSNL; NDR1; RIT42; Reducing Agents And Tunicamycin-Responsive Protein; TARG1; N-Myc Downstream-Regulated Gene 1 Protein; Rit42; Nickel-Specific Induction Pr
-
AA Sequence
MSREMQDVDLAEVKPLVEKGETITGLLQEFDVQEQDIETLHGSVHVTLCGTPKGNRPVILTYHDIGMNHKTCYNPLFNYEDMQEITQHFAVCHVDAPGQQDGAASFPAGYMYPSMDQLAEMLPGVLQQFGLKSIIGMGTGAGAYILTRFALNNPEMVEGLVLINVNPCAEGWMDWAASKISGWTQALPDMVVSHLFGKEEMQSNVEVVHTYRQHIVNDMNPGNLHLFINAYNSRRDLEIERPMPGTHTVTLQCPALLVVGDSSPAVDAVVECNSKLDPTKTTLLKMADCGGLPQISQPAKLAEAFKYFVQGMGYMPSASMTRLMRSRTASGSSVTSLDGTRSRSHTSEGTRSRSHTSEGTRSRSHTSEGAHLDITPNSGAAGNSAGPKSMEVSC
-
Predicted Molecular Mass
45 kDa
-
Molecular Weight
Approximately 52 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
