Nectin-4 Protein, Human (Biotinylated, 122a.a, HEK293, His-Avi)
The Nectin-4 Protein IgV domain is pivotal in cell adhesion, participating in trans-homophilic and -heterophilic interactions, notably with NECTIN1. While it doesn't serve as an alpha-herpesvirus entry receptor, it functions as a receptor for measles virus, enabling virus entry into host cells. This dual role underscores the importance of Nectin-4 in cell adhesion and its specific role as a measles virus infection receptor. Nectin-4, Human (Biotinylated, 122a.a, HEK293, His-Avi) is the recombinant human-derived Nectin-4 protein, expressed by HEK293, with C-Avi;C-hFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The Nectin-4 Protein IgV domain is pivotal in cell adhesion, participating in trans-homophilic and -heterophilic interactions, notably with NECTIN1. While it doesn't serve as an alpha-herpesvirus entry receptor, it functions as a receptor for measles virus, enabling virus entry into host cells. This dual role underscores the importance of Nectin-4 in cell adhesion and its specific role as a measles virus infection receptor. Nectin-4, Human (Biotinylated, 122a.a, HEK293, His-Avi) is the recombinant human-derived Nectin-4 protein, expressed by HEK293, with C-Avi;C-hFc labeled tag.
Background
The Nectin-4 Protein IgV domain plays a crucial role in cell adhesion, engaging in both trans-homophilic and -heterophilic interactions. Specifically, it forms interactions with NECTIN1, contributing to cellular adhesion processes. However, it does not function as a receptor for alpha-herpesvirus entry into cells. In the context of microbial infection, the Nectin-4 IgV domain acts as a receptor for measles virus, facilitating the entry of the virus into host cells. This highlights the dual role of Nectin-4 in cell adhesion and its significance as a specific receptor for measles virus infection.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag N-Avi;N-His
-
Accession
Q96NY8-1 (G32-L153)
-
Gene ID81607
-
Molecular Construction
-
N-term
-
His-Avi
-
Nectin-4 (G32-L153)
Accession # Q96NY8-1 -
C-term
-
-
Protein Length
Partial
-
Conjugation
Biotin
-
Synonyms
NECTIN4; Poliovirus Receptor-Related Protein 4; Prev. PVRL4; Poliovirus Receptor-Related 4; Nectin-4; Nectin 4; PRR4; EDSS1; LNIR; Nectin Cell Adhesion Molecule 4; Ig Superfamily Receptor LNIR
-
AA Sequence
GELETSDVVTVVLGQDAKLPCFYRGDSGEQVGQVAWARVDAGEGAQELALLHSKYGLHVSPAYEGRVEQPPPPRNPLDGSVLLRNAVQADEGEYECRVSTFPAGSFQARLRLRVLVPPLPSL
-
Predicted Molecular Mass
16.9 kDa
-
Molecular Weight
Approximately 18-20 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)