1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Neurotrophic Factors
  4. Neurotrophins/NGF
  5. NT-4/5
  6. Neurotrophin-4 Protein, Human (His)

Neurotrophin-4 (NT-4) protein serves as a vital target-derived survival factor for peripheral sensory sympathetic neurons, emphasizing its crucial role in promoting their survival and maintenance. The specific and targeted actions of NT-4 underscore its significance as a neurotrophic factor in the intricate mechanisms governing the well-being of peripheral neurons within the sympathetic nervous system. Neurotrophin-4 Protein, Human (His) is the recombinant human-derived Neurotrophin-4 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Neurotrophin-4 (NT-4) protein serves as a vital target-derived survival factor for peripheral sensory sympathetic neurons, emphasizing its crucial role in promoting their survival and maintenance. The specific and targeted actions of NT-4 underscore its significance as a neurotrophic factor in the intricate mechanisms governing the well-being of peripheral neurons within the sympathetic nervous system. Neurotrophin-4 Protein, Human (His) is the recombinant human-derived Neurotrophin-4 protein, expressed by E. coli , with N-6*His labeled tag.

Background

Neurotrophin-4 (NT-4) protein operates as a crucial target-derived survival factor specifically for peripheral sensory sympathetic neurons. Its pivotal role lies in supporting the survival and maintenance of these neurons, emphasizing NT-4's significance in promoting the health and functionality of peripheral sensory sympathetic neurons. The specific and targeted action of NT-4 underscores its role as a neurotrophic factor, playing a key part in the intricate mechanisms that govern the survival and well-being of peripheral neurons within the sympathetic nervous system.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

P34130 (V82-A210)

Gene ID

4909

Molecular Construction
N-term
6*His
Neurotrophin-4 (V82-A210)
Accession # P34130
C-term
Protein Length

Partial

Synonyms
rHuNT-4; NT-5; NTF4; NTF5; NT4
AA Sequence

VSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREVEVLGEVPAAGGSPLRQYFFETRCKADNAEEGGPGAGGGGCRGVDRRHWVSECKAKQSYVRALTADAQGRVGWRWIRIDTACVCTLLSRTGRA

Predicted Molecular Mass
17.9 kDa
Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

Neurotrophin-4 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Neurotrophin-4 Protein, Human (His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Neurotrophin-4 Protein, Human (His)
Cat. No.:
HY-P701335
Quantity:
MCE Japan Authorized Agent: