Neurotrophin-4 Protein, Human (His)
Based on 1 Customer Validation
Neurotrophin-4 (NT-4) protein serves as a vital target-derived survival factor for peripheral sensory sympathetic neurons, emphasizing its crucial role in promoting their survival and maintenance. The specific and targeted actions of NT-4 underscore its significance as a neurotrophic factor in the intricate mechanisms governing the well-being of peripheral neurons within the sympathetic nervous system. Neurotrophin-4 Protein, Human (His) is the recombinant human-derived Neurotrophin-4 protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
Neurotrophin-4 (NT-4) protein serves as a vital target-derived survival factor for peripheral sensory sympathetic neurons, emphasizing its crucial role in promoting their survival and maintenance. The specific and targeted actions of NT-4 underscore its significance as a neurotrophic factor in the intricate mechanisms governing the well-being of peripheral neurons within the sympathetic nervous system. Neurotrophin-4 Protein, Human (His) is the recombinant human-derived Neurotrophin-4 protein, expressed by E. coli , with N-6*His labeled tag.
Background
Neurotrophin-4 (NT-4) protein operates as a crucial target-derived survival factor specifically for peripheral sensory sympathetic neurons. Its pivotal role lies in supporting the survival and maintenance of these neurons, emphasizing NT-4's significance in promoting the health and functionality of peripheral sensory sympathetic neurons. The specific and targeted action of NT-4 underscores its role as a neurotrophic factor, playing a key part in the intricate mechanisms that govern the survival and well-being of peripheral neurons within the sympathetic nervous system.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
P34130 (V82-A210)
-
Gene ID4909
-
Molecular Construction
-
N-term
-
6*His
-
Neurotrophin-4 (V82-A210)
Accession # P34130 -
C-term
-
-
Protein Length
Full Length of Neurotrophin-4 Chain
-
Synonyms
NTF4; Neutrophic Factor 4; Prev. NTF5; NT-4; Neurotrophin-4; NT-5; NT-4/5; Neurotrophic Factor 5; GLC1O; GLC10; Neurotrophin 5 (Neurotrophin 4/5); NT4; Neurotrophic Factor 4; NT5; Neurotrophin 4; Neurotrophin-5
-
AA Sequence
VSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREVEVLGEVPAAGGSPLRQYFFETRCKADNAEEGGPGAGGGGCRGVDRRHWVSECKAKQSYVRALTADAQGRVGWRWIRIDTACVCTLLSRTGRA
-
Predicted Molecular Mass
17.9 kDa
-
Molecular Weight
Approximately 18 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)