Copy Link Print Information

Neurotrophin-4 Protein, Human (His)

Customer Review

Based on 1 Customer Validation

Neurotrophin-4 (NT-4) protein serves as a vital target-derived survival factor for peripheral sensory sympathetic neurons, emphasizing its crucial role in promoting their survival and maintenance. The specific and targeted actions of NT-4 underscore its significance as a neurotrophic factor in the intricate mechanisms governing the well-being of peripheral neurons within the sympathetic nervous system. Neurotrophin-4 Protein, Human (His) is the recombinant human-derived Neurotrophin-4 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Neurotrophin-4 Protein, Human (His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Neurotrophin-4 (NT-4) protein serves as a vital target-derived survival factor for peripheral sensory sympathetic neurons, emphasizing its crucial role in promoting their survival and maintenance. The specific and targeted actions of NT-4 underscore its significance as a neurotrophic factor in the intricate mechanisms governing the well-being of peripheral neurons within the sympathetic nervous system. Neurotrophin-4 Protein, Human (His) is the recombinant human-derived Neurotrophin-4 protein, expressed by E. coli , with N-6*His labeled tag.

Background

Neurotrophin-4 (NT-4) protein operates as a crucial target-derived survival factor specifically for peripheral sensory sympathetic neurons. Its pivotal role lies in supporting the survival and maintenance of these neurons, emphasizing NT-4's significance in promoting the health and functionality of peripheral sensory sympathetic neurons. The specific and targeted action of NT-4 underscores its role as a neurotrophic factor, playing a key part in the intricate mechanisms that govern the survival and well-being of peripheral neurons within the sympathetic nervous system.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession

    P34130 (V82-A210)

  • Gene ID
    4909
  • Molecular Construction
    • N-term
    • 6*His
    • Neurotrophin-4 (V82-A210)
      Accession # P34130
    • C-term
  • Protein Length

    Full Length of Neurotrophin-4 Chain

  • Synonyms

    NTF4; Neutrophic Factor 4; Prev. NTF5; NT-4; Neurotrophin-4; NT-5; NT-4/5; Neurotrophic Factor 5; GLC1O; GLC10; Neurotrophin 5 (Neurotrophin 4/5); NT4; Neurotrophic Factor 4; NT5; Neurotrophin 4; Neurotrophin-5

  • AA Sequence

    VSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREVEVLGEVPAAGGSPLRQYFFETRCKADNAEEGGPGAGGGGCRGVDRRHWVSECKAKQSYVRALTADAQGRVGWRWIRIDTACVCTLLSRTGRA

  • Predicted Molecular Mass

    17.9 kDa

  • Molecular Weight

    Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • Neurotrophin-4 Protein, Human (His) Product Image
    1/16
  • Neurotrophin-4 Protein, Human (His) Product Image