NKG2A Protein, Human (HEK293, His)
Based on 1 Customer Validation
The NKG2A protein is an important immunosuppressive receptor that forms a complex with KLRD1 on lymphocyte subsets for self-non-self discrimination. It recognizes HLA-E loaded with self-peptides, monitors MHC class I expression in healthy cells, and promotes self-tolerance. NKG2A Protein, Human (HEK293, His) is the recombinant human-derived NKG2A protein, expressed by HEK293 , with N-8*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The NKG2A protein is an important immunosuppressive receptor that forms a complex with KLRD1 on lymphocyte subsets for self-non-self discrimination. It recognizes HLA-E loaded with self-peptides, monitors MHC class I expression in healthy cells, and promotes self-tolerance. NKG2A Protein, Human (HEK293, His) is the recombinant human-derived NKG2A protein, expressed by HEK293 , with N-8*His labeled tag.
Background
NKG2A Protein, an immune inhibitory receptor crucial for self-nonself discrimination, forms a complex with KLRD1 on cytotoxic and regulatory lymphocyte subsets, recognizing the non-classical major histocompatibility (MHC) class Ib molecule HLA-E loaded with self-peptides from the signal sequence of classical MHC class Ia molecules. This recognition allows cytotoxic cells to monitor MHC class I expression in healthy cells and promotes self-tolerance. Upon binding to HLA-E-peptide complexes, NKG2A transmits intracellular signals through two immunoreceptor tyrosine-based inhibition motifs (ITIMs), recruiting INPP5D/SHP-1 and INPPL1/SHP-2 tyrosine phosphatases to oppose signals from activating receptors. As a key inhibitory receptor on natural killer (NK) cells, NKG2A regulates their activation and effector functions, countering T cell receptor signaling on a subset of memory/effector CD8-positive T cells and distinguishing harmless from pathogenic antigens. In the HLA-E-rich tumor microenvironment, NKG2A acts as an immune inhibitory checkpoint, contributing to the progressive loss of effector functions in NK cells and tumor-specific T cells, a phenomenon known as cell exhaustion. Notably, during viral infection, NKG2A recognizes HLA-E in complex with human cytomegalovirus-derived peptides, inhibiting NK cell cytotoxicity and facilitating viral immune escape.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag N-8*His
-
Accession
P26715-1 (R100-L233)
-
Molecular Construction
-
N-term
-
8*His
-
NKG2A (R100-L233)
Accession # P26715-1 -
C-term
-
-
Protein Length
Partial Extracellular Domain
-
Synonyms
KLRC1; NKG2-A/B-Activating NK Receptor; Prev. NKG2; NKG2-B; NKG2-A; NKG2A; CD159a; NKG2-A/B Type II Integral Membrane Protein; Killer Cell Lectin-Like Receptor Subfamily C, Member 1; Natural Killer Group Protein 2; NKG2-A/NKG2-B Type II Integral Membrane
-
AA Sequence
RHNNSSLNTRTQKARHCGHCPEEWITYSNSCYYIGKERRTWEESLLACTSKNSSLLSIDNEEEMKFLSIISPSSWIGVFRNSSHHPWVTMNGLAFKHEIKDSDNAELNCAVLQVNRLKSAQCGSSIIYHCKHKL
-
Predicted Molecular Mass
16.5 kDa
-
Molecular Weight
Approximately 25-40 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (254 KB)
- English - EN (254 KB)
- Français - FR (254 KB)
- Deutsch - DE (254 KB)
- Norwegian - NO (254 KB)
- Español - ES (254 KB)
- Swedish - SV (254 KB)
- Italian - IT (254 KB)
- Korean - KR (254 KB)
- Portuguese - PT (254 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)