NKG2C/CD159c Protein, Human (HEK293, hFc)

The NKG2C/CD159c protein is an immune-activating receptor that plays a critical role in self-non-self discrimination. It cooperates with KLRD1 to recognize non-classical MHC class Ib HLA-E loaded with HLA-G peptides, affecting adaptive NK cell function and maternal-fetal tolerance. NKG2C/CD159c Protein, Human (HEK293, hFc) is the recombinant human-derived NKG2C/CD159c protein, expressed by HEK293 , with C-hFc labeled tag.

NKG2C/CD159c Protein, an immune activating receptor, plays a pivotal role in self-nonself discrimination. Teaming up with KLRD1 on cytotoxic lymphocyte subsets, it recognizes non-classical major histocompatibility (MHC) class Ib HLA-E loaded with signal sequence-derived peptides from non-classical MHC class Ib HLA-G molecules. This interaction likely contributes to the generation and effector functions of adaptive natural killer (NK) cells and is implicated in maternal-fetal tolerance during pregnancy. NKG2C/CD159c also regulates the effector functions of terminally differentiated cytotoxic lymphocyte subsets, particularly in the adaptive NK cell response to viral infection. Upon binding to HLA-E-peptide complexes, NKG2C/CD159c transmits intracellular signals through the adapter protein TYROBP/DAP12, initiating the phosphorylation of proximal signaling molecules and subsequent cell activation. Forming a heterodimer with KLRD1 through disulfide linkage, the KLRD1-KLRC2 receptor complex, in association with TYROBP homodimers, is crucial for its cell surface expression. Additionally, this receptor complex can bind with low affinity to HLA-E loaded with self-peptides derived from the signal sequence of classical MHC class Ia. The multifaceted interactions and functions of NKG2C/CD159c underscore its essential role in immune responses and self-tolerance mechanisms.

Human

HEK293

C-hFc

P26717 (E98-L231)

3822  [NCBI]

Extracellular Domain

EQNNFSPNTRTQKARHCGHCPEEWITYSNSCYYIGKERRTWEESLLACTSKNSSLLSIDNEEEMKFLASILPSSWIGVFRNSSHHPWVTINGLAFKHKIKDSDNAELNCAVLQVNRLKSAQCGSSMIYHCKHKL

Approximately 48-58 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

≥ 95%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.