NKG2D/CD314 Protein, Mouse (HEK293, Fc)
The NKG2D/CD314 protein activates and stimulates the innate immune response of NK cells by binding to stress-inducing ligands on tumor and virus-infected cells.It also acts as a costimulatory receptor for TCR, enhancing T cell activation and eliminating tumor cells.NKG2D/CD314 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived NKG2D/CD314 protein, expressed by HEK293 , with N-hFc labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The NKG2D/CD314 protein activates and stimulates the innate immune response of NK cells by binding to stress-inducing ligands on tumor and virus-infected cells.It also acts as a costimulatory receptor for TCR, enhancing T cell activation and eliminating tumor cells.NKG2D/CD314 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived NKG2D/CD314 protein, expressed by HEK293 , with N-hFc labeled tag.
Background
NKG2D/CD314 Protein functions as an activating and costimulatory receptor critical for immunosurveillance, binding to stress-inducible ligands on autologous tumor cells and virus-infected cells. This engagement triggers stimulatory and costimulatory innate immune responses in activated killer (NK) cells, leading to cytotoxic activity. In CD8(+) T-cell-mediated adaptive immune responses, NKG2D acts as a costimulatory receptor for the T-cell receptor (TCR), amplifying T-cell activation and stimulating perforin-mediated elimination of ligand-expressing tumor cells. Signaling involves calcium influx, culminating in TNF-alpha expression. NKG2D participates in NK cell-mediated bone marrow graft rejection and may regulate NK cell differentiation and survival. The protein forms a homodimer through disulfide linkage and a heterohexamer with HCST/DAP10, crucial for NK cell surface expression and induction of cytotoxicity. It interacts with various ligands, including RAET1A, RAET1B, RAET1C, RAET1D, RAET1E, H60, and MULT1, belonging to MHC class I-related glycoproteins subfamilies. Additionally, NKG2D interacts with CEACAM1, recruiting PTPN6 for VAV1 dephosphorylation, highlighting its role in orchestrating complex immune responses.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag N-hFc
-
Accession
O54709 (F90-V232)
-
Molecular Construction
-
N-term
-
hFc
-
NKG2D (F90-V232)
Accession # O54709 -
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
KLRK1; CD314; Prev. D12S2489E; Killer Cell Lectin-Like Receptor Subfamily K, Member 1; NKG2D; NKG2-D-Activating NK Receptor; NKG2-D Type II Integral Membrane Protein; DNA Segment On Chromosome 12 (Unique) 2489 Expressed Sequence; NK Cell Receptor D; Kille
-
AA Sequence
FKETFQPVLCNKEVPVSSREGYCGPCPNNWICHRNNCYQFFNEEKTWNQSQASCLSQNSSLLKIYSKEEQDFLKLVKSYHWMGLVQIPANGSWQWEDGSSLSYNQLTLVEIPKGSCAVYGSSFKAYTEDCANLNTYICMKRAV
-
Predicted Molecular Mass
43.7 kDa
-
Molecular Weight
Approximately 50-68 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)