1. Recombinant Proteins
  2. CAR-T Related Proteins CD Antigens
  3. T Cell CD Proteins NK Cell CD Proteins
  4. CD314/NKG2D
  5. NKG2D/CD314 Protein, Mouse (HEK293, Fc)

The NKG2D/CD314 protein activates and stimulates the innate immune response of NK cells by binding to stress-inducing ligands on tumor and virus-infected cells.It also acts as a costimulatory receptor for TCR, enhancing T cell activation and eliminating tumor cells.NKG2D/CD314 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived NKG2D/CD314 protein, expressed by HEK293 , with N-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The NKG2D/CD314 protein activates and stimulates the innate immune response of NK cells by binding to stress-inducing ligands on tumor and virus-infected cells.It also acts as a costimulatory receptor for TCR, enhancing T cell activation and eliminating tumor cells.NKG2D/CD314 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived NKG2D/CD314 protein, expressed by HEK293 , with N-hFc labeled tag.

Background

NKG2D/CD314 Protein functions as an activating and costimulatory receptor critical for immunosurveillance, binding to stress-inducible ligands on autologous tumor cells and virus-infected cells. This engagement triggers stimulatory and costimulatory innate immune responses in activated killer (NK) cells, leading to cytotoxic activity. In CD8(+) T-cell-mediated adaptive immune responses, NKG2D acts as a costimulatory receptor for the T-cell receptor (TCR), amplifying T-cell activation and stimulating perforin-mediated elimination of ligand-expressing tumor cells. Signaling involves calcium influx, culminating in TNF-alpha expression. NKG2D participates in NK cell-mediated bone marrow graft rejection and may regulate NK cell differentiation and survival. The protein forms a homodimer through disulfide linkage and a heterohexamer with HCST/DAP10, crucial for NK cell surface expression and induction of cytotoxicity. It interacts with various ligands, including RAET1A, RAET1B, RAET1C, RAET1D, RAET1E, H60, and MULT1, belonging to MHC class I-related glycoproteins subfamilies. Additionally, NKG2D interacts with CEACAM1, recruiting PTPN6 for VAV1 dephosphorylation, highlighting its role in orchestrating complex immune responses.

Species

Mouse

Source

HEK293

Tag

N-hFc

Accession

O54709 (F90-V232)

Gene ID
Molecular Construction
N-term
hFc
NKG2D (F90-V232)
Accession # O54709
C-term
Protein Length

Extracellular Domain

Synonyms
CD314; D12S2489E; KLR; NKG2-D; NKG2D
AA Sequence

FKETFQPVLCNKEVPVSSREGYCGPCPNNWICHRNNCYQFFNEEKTWNQSQASCLSQNSSLLKIYSKEEQDFLKLVKSYHWMGLVQIPANGSWQWEDGSSLSYNQLTLVEIPKGSCAVYGSSFKAYTEDCANLNTYICMKRAV

Predicted Molecular Mass
43.7 kDa
Molecular Weight

Approximately 50-68 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Glycosylation
Yes
Purity

≥ 95%, as determined by Bis-Tris PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

NKG2D/CD314 Protein, Mouse (HEK293, Fc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
NKG2D/CD314 Protein, Mouse (HEK293, Fc)
Cat. No.:
HY-P78330
Quantity:
MCE Japan Authorized Agent: