NKG2D/CD314 Protein, Mouse (sf9, Fc)
NKG2D is an activating cell surface receptor that associates selectively with DAP10, an YxxM-bearing adaptor protein.NKG2D/CD314 Protein, Mouse (sf9, Fc) is the recombinant mouse-derived NKG2D/CD314 protein, expressed by Sf9 insect cells , with N-hFc labeled tag.
- Species: Mouse
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
NKG2D is an activating cell surface receptor that associates selectively with DAP10, an YxxM-bearing adaptor protein.NKG2D/CD314 Protein, Mouse (sf9, Fc) is the recombinant mouse-derived NKG2D/CD314 protein, expressed by Sf9 insect cells , with N-hFc labeled tag.
Background
NKG2D is an activating cell surface receptor that associates selectively with DAP10, an YxxM-bearing adaptor protein. NKG2D enables several functions, including MHC class I protein binding activity, MHC class Ib receptor activity and identical protein binding activity. NKG2D is involved in positive regulation of natural killer cell mediated cytotoxicity. NKG2D acts upstream of or within several processes, including positive regulation of interferon-gamma production, positive regulation of nitric oxide biosynthetic process and response to bacterium. NKG2D is located in external side of plasma membrane[1][2][3].
Technical Parameters
-
Species Mouse
-
Source Sf9 insect cells
-
Tag N-hFc
-
Accession
NP_001076791.1 (F77-V219)
-
Molecular Construction
-
N-term
-
hFc
-
NKG2D (F77-V219)
Accession # NP_001076791.1 -
C-term
-
-
Protein Length
Partial
-
Synonyms
KLRK1; CD314; Prev. D12S2489E; Killer Cell Lectin-Like Receptor Subfamily K, Member 1; NKG2D; NKG2-D-Activating NK Receptor; NKG2-D Type II Integral Membrane Protein; DNA Segment On Chromosome 12 (Unique) 2489 Expressed Sequence; NK Cell Receptor D; Kille
-
AA Sequence
FKETFQPVLCNKEVPVSSREGYCGPCPNNWICHRNNCYQFFNEEKTWNQSQASCLSQNSSLLKIYSKEEQDFLKLVKSYHWMGLVQIPANGSWQWEDGSSLSYNQLTLVEIPKGSCAVYGSSFKAYTEDCANLNTYICMKRAV
-
Predicted Molecular Mass
44.9 kDa
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
