NKG2DL2 Protein, Human (Biotinylated, HEK293, His-Avi)
Based on 1 Customer Validation
NKG2DL2 Protein activates KLRK1/NKG2D receptor, promoting natural killer cell cytotoxicity. Importantly, it does not bind beta2-microglobulin, confirmed by research findings. NKG2DL2 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived NKG2DL2 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
NKG2DL2 Protein activates KLRK1/NKG2D receptor, promoting natural killer cell cytotoxicity. Importantly, it does not bind beta2-microglobulin, confirmed by research findings. NKG2DL2 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived NKG2DL2 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.
Background
The NKG2DL2 protein functions by binding to and activating the KLRK1/NKG2D receptor, thereby facilitating natural killer cell cytotoxicity. Its interaction with KLRK1/NKG2D has been documented. Notably, this protein does not exhibit binding affinity to beta2-microglobulin, as indicated by research findings.
Verified Bioactivity
Immobilized Biotinylated Human ULBP-2 His at 1 μg/mL (100μL/Well) on the streptavidin precoated plate (5 μg/mL). Dose response curve for Human NKG2D hFc with the EC50 of <2 μg/mL determined by ELISA.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-Avi;C-8*His
-
Accession
Q9BZM5 (G26-S217)
-
Molecular Construction
-
N-term
-
NKG2DL2 (G26-S217)
Accession # Q9BZM5 -
8*His-Avi
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Conjugation
Biotin
-
Synonyms
ULBP2; UL16 Binding Protein 2; RAET1H; Retinoic Acid Early Transcript 1H; UL16-Binding Protein 2; NKG2D Ligand 2; ALCAN-Alpha; NKG2DL2; N2DL2; N2DL-2
-
AA Sequence
GRADPHSLCYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKTVTPVSPLGKKLNVTTAWKAQNPVLREVVDILTEQLRDIQLENYTPKEPLTLQARMSCEQKAEGHSSGSWQFSFDGQIFLLFDSEKRMWTTVHPGARKMKEKWENDKVVAMSFHYFSMGDCIGWLEDFLMGMDSTLEPSAGAPLAMSS
-
Predicted Molecular Mass
24.6 kDa
-
Molecular Weight
Approximately 30-40 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
