NKp30/NCR3 Protein, Human (Biotinylated, HEK293, His-Avi)
Based on 1 Customer Validation
NKp30/NCR3 protein is a cell membrane receptor on NK cells and is activated by binding to ligands such as BAG6 and NCR3LG1. This activation enhances NK cell cytotoxicity against neighboring cells that produce these ligands, including tumor cells. NKp30/NCR3 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived NKp30/NCR3 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
NKp30/NCR3 protein is a cell membrane receptor on NK cells and is activated by binding to ligands such as BAG6 and NCR3LG1. This activation enhances NK cell cytotoxicity against neighboring cells that produce these ligands, including tumor cells. NKp30/NCR3 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived NKp30/NCR3 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.
Background
The NKp30/NCR3 protein serves as a cell membrane receptor on natural killer (NK) cells, becoming activated upon binding to extracellular ligands such as BAG6 and NCR3LG1. This activation stimulates NK cell cytotoxicity directed towards neighboring cells producing these ligands, thereby controlling NK cell cytotoxicity against various targets, including tumor cells. The engagement of NCR3 by BAG6 not only enhances NK cell-mediated killing of myeloid dendritic cells (DCs) that did not acquire a mature phenotype but also induces the release of TNFA and IFNG by NK cells. This, in turn, promotes the maturation of myeloid dendritic cells. In its unliganded form, NKp30/NCR3 exists as a homodimer and interacts with CD3Z, NCR3LG1, and BAG6, highlighting its role as a multifaceted regulator in immune responses and NK cell-mediated cytotoxicity.
Verified Bioactivity
Measured by its binding ability in a functional ELISA. When immobilized Anti-NKp30 Antibody at 0.5 μg/mL (100μL/Well) on the plate, it binds Anti-NKp30 Antibody with an EC50 of 48.9 ng/mL.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-Avi;C-8*His
-
Accession
O14931-1 (L19-T138)
-
Molecular Construction
-
N-term
-
NKp30 (L19-T138)
Accession # O14931-1 -
8*His-Avi
-
C-term
-
-
Protein Length
Extracellular Domain
-
Conjugation
Biotin
-
Synonyms
NCR3; Activating Natural Killer Receptor P30; Prev. LY117; NK-P30; NKp30; Activating NK-A1 Receptor; 1C7; CD337 Antigen; Natural Killer Cell P30-Related Protein; MALS; CD337; Natural Cytotoxicity Triggering Receptor 3; Lymphocyte Antigen 117
-
AA Sequence
LWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLGAGT
-
Predicted Molecular Mass
20 kDa
-
Molecular Weight
Approximately 26-45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)