NKp46/NCR1 Protein, Mouse (HEK293, His)
Based on 1 Customer Validation
NKp46/NCR1 Protein, a cytotoxicity-activating receptor, boosts activated natural killer (NK) cells' efficacy in eliminating tumor cells.Its interaction with CD3Z and FCER1G suggests a potential role in aiding NK cells in recognizing and destroying cancerous cells.NKp46/NCR1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived NKp46/NCR1 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
NKp46/NCR1 Protein, a cytotoxicity-activating receptor, boosts activated natural killer (NK) cells' efficacy in eliminating tumor cells.Its interaction with CD3Z and FCER1G suggests a potential role in aiding NK cells in recognizing and destroying cancerous cells.NKp46/NCR1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived NKp46/NCR1 protein, expressed by HEK293 , with C-His labeled tag.
Background
NKp46/NCR1 Protein is a cytotoxicity-activating receptor that enhances the effectiveness of activated natural killer (NK) cells in killing tumor cells. It interacts with CD3Z and FCER1G, potentially aiding in the recognition and destruction of cancerous cells by NK cells.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-8*His
-
Accession
Q8C567 (E22-N255)
-
Molecular Construction
-
N-term
-
NKp46 (E22-N255)
Accession # Q8C567 -
8*His
-
C-term
-
-
Protein Length
Partial Extracellular Domain
-
Synonyms
NCR1; NK Cell-Activating Receptor; Prev. LY94; Lymphocyte Antigen 94 Homolog (Activating NK-Receptor; NK-P46); NK-P46; Lymphocyte Antigen 94 Homolog; Natural Killer Cell P46-Related Protein; CD335 Antigen; NKP46; HNKp46; CD335; NKp46; Natural Cytotoxicity
-
AA Sequence
EKETLPKPIIWAKPSIMVTNGNSVNIWCQGAQSASEYQLYFEGSFFALERPKPSRSMNKVRFFISQMTSHTAGIYTCFYQSGELWSKSSNPLKLVVTGLYDTPNLWVYPRPEVTLGENVTFFCQLKTATSKFFLLKERGSNHIQNKYGNIQAEFPMGPVTRAHRGTYRCFGSYNDYAWSFPSEPVTLLITGGVENSSLAPTDPTSSLDYWEFDLSTNESGLQKDSAFWDHTTQN
-
Predicted Molecular Mass
27.7 kDa
-
Molecular Weight
Approximately 40-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Normally 8% trehalose is added as protectant before lyophilization.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
