NOV/CCN3 Protein, Rhesus Macaque (sf9, His)

NOV/CCN3 proteins are involved in a variety of biological processes, including migration, differentiation, survival, and inflammation. It acts by binding to integrins or membrane receptors such as NOTCH1. NOV/CCN3 Protein, Rhesus Macaque (sf9, His) is the recombinant Rhesus Macaque-derived NOV/CCN3 protein, expressed by Sf9 insect cells , with C-His labeled tag.

NOV/CCN3 protein is involved in various biological processes including migration, differentiation, survival, and inflammation. It acts by binding to integrins or membrane receptors such as NOTCH1. It is an essential regulator of hematopoietic stem and progenitor cells and inhibits myogenic differentiation through the activation of the Notch-signaling pathway. It also inhibits vascular smooth muscle cell proliferation and supports endothelial cell adhesion, migration, and survival, promoting angiogenesis. In cutaneous wound healing, it acts as an integrin receptor ligand, supporting fibroblast adhesion and chemotaxis. It is involved in bone regeneration and enhances the articular chondrocytic phenotype while repressing endochondral ossification. It impairs pancreatic beta-cell function and plays a role as a negative regulator of endothelial pro-inflammatory activation, reducing monocyte adhesion and inhibiting NF-kappaB signaling pathway. Additionally, it contributes to the control and coordination of inflammatory processes in atherosclerosis and attenuates inflammatory pain by regulating the expression of MMP9, MMP2, and CCL2.

Rhesus Macaque

Sf9 insect cells

C-His

F6WCM6 (T32-M357)

702196  [NCBI]

Full Length of Mature Protein

TQRCPPQCPGQCPTTPPTCAPGVRAVLDGCSCCPVCARQRGESCSDLEPCDESSGLYCDRSADPSNQTGICMAVEGDNCVFDGVIYRSGEKFQPSCKFQCTCRDGQIGCVPRCQLDVLLPEPNCPAPRKVEVPGECCEKWICGPDEEDSLGGLTLAAYRPEATLGVEVSDSSVNCIEQTTEWTACSKSCGMGFSTRVTNRNRQCEMLKQTRLCMVRPCEQEPEQPTDKKGKKCLRTKKSLKAIHLQFKNCTSLHTYKPRFCGVCSDGRCCTPHNTKTIQAEFQCSPGQIVKKPVMVIGTCTCHTNCPKNNEAFLQELELKTTRGKM

≥ 80%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.