NOV/CCN3 Protein, Rhesus Macaque (sf9, His)
NOV/CCN3 proteins are involved in a variety of biological processes, including migration, differentiation, survival, and inflammation. It acts by binding to integrins or membrane receptors such as NOTCH1. NOV/CCN3 Protein, Rhesus Macaque (sf9, His) is the recombinant Rhesus Macaque-derived NOV/CCN3 protein, expressed by Sf9 insect cells , with C-His labeled tag.
- Species: Rhesus Macaque
- Source: Sf9 insect cells
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
NOV/CCN3 proteins are involved in a variety of biological processes, including migration, differentiation, survival, and inflammation. It acts by binding to integrins or membrane receptors such as NOTCH1. NOV/CCN3 Protein, Rhesus Macaque (sf9, His) is the recombinant Rhesus Macaque-derived NOV/CCN3 protein, expressed by Sf9 insect cells , with C-His labeled tag.
Background
NOV/CCN3 protein is involved in various biological processes including migration, differentiation, survival, and inflammation. It acts by binding to integrins or membrane receptors such as NOTCH1. It is an essential regulator of hematopoietic stem and progenitor cells and inhibits myogenic differentiation through the activation of the Notch-signaling pathway. It also inhibits vascular smooth muscle cell proliferation and supports endothelial cell adhesion, migration, and survival, promoting angiogenesis. In cutaneous wound healing, it acts as an integrin receptor ligand, supporting fibroblast adhesion and chemotaxis. It is involved in bone regeneration and enhances the articular chondrocytic phenotype while repressing endochondral ossification. It impairs pancreatic beta-cell function and plays a role as a negative regulator of endothelial pro-inflammatory activation, reducing monocyte adhesion and inhibiting NF-kappaB signaling pathway. Additionally, it contributes to the control and coordination of inflammatory processes in atherosclerosis and attenuates inflammatory pain by regulating the expression of MMP9, MMP2, and CCL2.
Technical Parameters
-
Species Rhesus Macaque
-
Source Sf9 insect cells
-
Tag C-His
-
Accession
F6WCM6 (T32-M357)
-
Molecular Construction
-
N-term
-
CCN3 (T32-M357)
Accession # F6WCM6 -
His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
CCN3; Protein NOV Homolog; Prev. NOV; IBP-9; IGFBP9; Nephroblastoma-Overexpressed Gene Protein Homolog; Nephro Blastoma-Overexpressed Gene Protein Homolog; Nephroblastoma Overexpressed Gene; Insulin-Like Growth Factor-Binding Protein 9; NOVh; Nephroblasto
-
AA Sequence
TQRCPPQCPGQCPTTPPTCAPGVRAVLDGCSCCPVCARQRGESCSDLEPCDESSGLYCDRSADPSNQTGICMAVEGDNCVFDGVIYRSGEKFQPSCKFQCTCRDGQIGCVPRCQLDVLLPEPNCPAPRKVEVPGECCEKWICGPDEEDSLGGLTLAAYRPEATLGVEVSDSSVNCIEQTTEWTACSKSCGMGFSTRVTNRNRQCEMLKQTRLCMVRPCEQEPEQPTDKKGKKCLRTKKSLKAIHLQFKNCTSLHTYKPRFCGVCSDGRCCTPHNTKTIQAEFQCSPGQIVKKPVMVIGTCTCHTNCPKNNEAFLQELELKTTRGKM
-
Predicted Molecular Mass
37.2 kDa
-
Purity
≥ 80%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
