1. Recombinant Proteins
  2. Others
  3. NOV/CCN3 Protein, Rhesus Macaque (sf9, His)

NOV/CCN3 proteins are involved in a variety of biological processes, including migration, differentiation, survival, and inflammation. It acts by binding to integrins or membrane receptors such as NOTCH1. NOV/CCN3 Protein, Rhesus Macaque (sf9, His) is the recombinant Rhesus Macaque-derived NOV/CCN3 protein, expressed by Sf9 insect cells , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

NOV/CCN3 proteins are involved in a variety of biological processes, including migration, differentiation, survival, and inflammation. It acts by binding to integrins or membrane receptors such as NOTCH1. NOV/CCN3 Protein, Rhesus Macaque (sf9, His) is the recombinant Rhesus Macaque-derived NOV/CCN3 protein, expressed by Sf9 insect cells , with C-His labeled tag.

Background

NOV/CCN3 protein is involved in various biological processes including migration, differentiation, survival, and inflammation. It acts by binding to integrins or membrane receptors such as NOTCH1. It is an essential regulator of hematopoietic stem and progenitor cells and inhibits myogenic differentiation through the activation of the Notch-signaling pathway. It also inhibits vascular smooth muscle cell proliferation and supports endothelial cell adhesion, migration, and survival, promoting angiogenesis. In cutaneous wound healing, it acts as an integrin receptor ligand, supporting fibroblast adhesion and chemotaxis. It is involved in bone regeneration and enhances the articular chondrocytic phenotype while repressing endochondral ossification. It impairs pancreatic beta-cell function and plays a role as a negative regulator of endothelial pro-inflammatory activation, reducing monocyte adhesion and inhibiting NF-kappaB signaling pathway. Additionally, it contributes to the control and coordination of inflammatory processes in atherosclerosis and attenuates inflammatory pain by regulating the expression of MMP9, MMP2, and CCL2.

Species

Rhesus Macaque

Source

Sf9 insect cells

Tag

C-His

Accession

F6WCM6 (T32-M357)

Gene ID
Molecular Construction
N-term
CCN3 (T32-M357)
Accession # F6WCM6
His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Nephroblastoma Overexpressed Gene Protein; IBP-9; CCN3; IGFBP9; NOVH
AA Sequence

TQRCPPQCPGQCPTTPPTCAPGVRAVLDGCSCCPVCARQRGESCSDLEPCDESSGLYCDRSADPSNQTGICMAVEGDNCVFDGVIYRSGEKFQPSCKFQCTCRDGQIGCVPRCQLDVLLPEPNCPAPRKVEVPGECCEKWICGPDEEDSLGGLTLAAYRPEATLGVEVSDSSVNCIEQTTEWTACSKSCGMGFSTRVTNRNRQCEMLKQTRLCMVRPCEQEPEQPTDKKGKKCLRTKKSLKAIHLQFKNCTSLHTYKPRFCGVCSDGRCCTPHNTKTIQAEFQCSPGQIVKKPVMVIGTCTCHTNCPKNNEAFLQELELKTTRGKM

Predicted Molecular Mass
37.2 kDa
Purity

≥ 80%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

NOV/CCN3 Protein, Rhesus Macaque (sf9, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

NOV/CCN3 Protein, Rhesus Macaque (sf9, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
NOV/CCN3 Protein, Rhesus Macaque (sf9, His)
Cat. No.:
HY-P77454
Quantity:
MCE Japan Authorized Agent: