NPR1/NPRA Protein, Mouse (HEK293, His)
NPR1/NPRA Protein, Mouse (HEK293, His) is the recombinant mouse-derived NPR1/NPRA protein, expressed by HEK293, with C-His tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
NPR1/NPRA Protein, Mouse (HEK293, His) is the recombinant mouse-derived NPR1/NPRA protein, expressed by HEK293, with C-His tag.
Background
NPR1/NPRA is a receptor for the atrial natriuretic peptide NPPA/ANP and the brain natriuretic peptide NPPB/BNP, which are potent vasoactive hormones playing a key role in cardiovascular homeostasis. It plays an essential role in regulating endothelial cell senescence and vascular aging. Upon activation by ANP or BNP, NPR1/NPRA stimulates the production of cyclic guanosine monophosphate (cGMP), which promotes vascular tone and volume homeostasis by activating protein kinase cGMP-dependent 1/PRKG1 and subsequently PRKAA1, thereby controlling blood pressure and maintaining cardiovascular homeostasis.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-8*His
-
Accession
NP_032753.5 (S29-E469)
-
Gene ID18160
-
Protein Length
Extracellular Domain
-
Synonyms
NPR1; ANPR-A; Prev. ANPRA; ANP-A; Prev. NPRA; GC-A; Guanylate Cyclase A; Natriuretic Peptide Receptor A/Guanylate Cyclase A (Atrionatriuretic Peptide Receptor A); GUCY2A; Natriuretic Peptide A Type Receptor; ANPa; Testicular Tissue Protein Li 20; Atrial N
-
AA Sequence
SDLTVAVVLPLTNTSYPWSWARVGPAVELALGRVKARPDLLPGWTVRMVLGSSENAAGVCSDTAAPLAAVDLKWEHSPAVFLGPGCVYSAAPVGRFTAHWRVPLLTAGAPALGIGVKDEYALTTRTGPSHVKLGDFVTALHRRLGWEHQALVLYADRLGDDRPCFFIVEGLYMRVRERLNITVNHQEFVEGDPDHYTKLLRTVQRKGRVIYICSSPDAFRNLMLLALDAGLTGEDYVFFHLDVFGQSLQGAQGPVPRKPWERDDGQDRRARQAFQAAKIITYKEPDNPEYLEFLKQLKLLADKKFNFTMEDGLKNIIPASFHDGLLLYVQAVTETLAQGGTVTDGENITQRMWNRSFQGVTGYLKIDRNGDRDTDFSLWDMDPETGAFRVVLNFNGTSQELMAVSEHRLYWPLGYPPPDIPKCGFDNEDPACNQDHFSTLE
-
Predicted Molecular Mass
50.9 kDa
-
Molecular Weight
Approximately 60-70 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)