1. Recombinant Proteins
  2. Receptor Proteins Enzymes & Regulators Biotinylated Proteins Kinases
  3. Receptor Tyrosine Kinases Transferases (EC 2) Protein Tyrosine Kinases TK
  4. Trk Receptors TrkA Trk
  5. TrkA Protein, Human (Biotinylated, sf9, Flag, Avi)

TrkA Protein, Human (Biotinylated, sf9, Flag, Avi)

Art. -Nr.: HY-P702762
Handling Instructions Technical Support

TrkA protein is an important receptor tyrosine kinase that regulates the development of the central and peripheral nervous systems and affects the proliferation, differentiation, and survival of neurons. As a high-affinity receptor for NGF, TrkA is activated upon NGF binding through homodimerization and autophosphorylation. TrkA Protein, Human (Biotinylated, sf9, Flag, Avi) is the recombinant human-derived NTRK1/TrkA-I, expressed by Sf9 insect cells, with Avi, Flag labeled tag.

Nur für Forschungszwecke. Wir verkaufen nicht an Patienten.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Größe Verfügbarkeit
50 μg   Angebot einholen  
100 μg   Angebot einholen  

* Bitte wählen Sie Menge, bevor Sie Artikel hinzufügen.

Top Publications Citing Use of Products
  • Biologische Aktivität

  • Technical Parameters

  • Properties

  • Beschreibung

Beschreibung

TrkA protein is an important receptor tyrosine kinase that regulates the development of the central and peripheral nervous systems and affects the proliferation, differentiation, and survival of neurons. As a high-affinity receptor for NGF, TrkA is activated upon NGF binding through homodimerization and autophosphorylation. TrkA Protein, Human (Biotinylated, sf9, Flag, Avi) is the recombinant human-derived NTRK1/TrkA-I, expressed by Sf9 insect cells, with Avi, Flag labeled tag.

Background

TrkA Protein, a receptor tyrosine kinase, plays a crucial role in the development and maturation of both the central and peripheral nervous systems, exerting control over the proliferation, differentiation, and survival of sympathetic and sensory neurons. Functioning as a high-affinity receptor for NGF, its primary ligand, TrkA undergoes homodimerization, autophosphorylation, and activation upon dimeric NGF ligand-binding. This activation leads to the recruitment, phosphorylation, and/or activation of downstream effectors, including SHC1, FRS2, SH2B1, SH2B2, and PLCG1, orchestrating distinct signaling cascades that drive cell survival and differentiation. TrkA regulates diverse cellular processes through pathways such as the GRB2-Ras-MAPK cascade, Ras-PI3 kinase-AKT1 signaling, and NF-Kappa-B activation. In the absence of ligand and activation, TrkA may contribute to cell death, emphasizing the dependence of neuron survival on trophic factors. Interestingly, it exhibits resistance to NGF, constitutively activating AKT1 and NF-kappa-B, while unable to activate the Ras-MAPK signaling cascade. TrkA also antagonizes the anti-proliferative NGF-NTRK1 signaling, promoting neuronal precursor differentiation. The isoform TrkA-III additionally plays a role in angiogenesis and exhibits oncogenic activity upon overexpression.

Species

Human

Source

Sf9 insect cells

Tag

N-Avi;N-Flag

Accession

P04629-2 (C436-G790)

Gene ID

4914

Protein Length

Partial

Conjugation

Biotin

Synonyms
High affinity nerve growth factor receptor; Neurotrophic tyrosine kinase receptor type 1; NTRK-1; NTRK1; Slow nerve growth factor receptor; p140-TrkA; Trk-A; Trk; Trka; TRK1-transforming tyrosine kinase protein; TRKAOncogene TRK; TRKTRK1; tyrosine kinase receptor A
AA Sequence

CGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSSLSPTEGKGSGLQGHIIENPQYFSDACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKEASESARQDFQREAELLTMLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNCLVGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRELERPRACPPEVYAIMRGCWQREPQQRHSIKDVHARLQALAQAPPVYLDVLG

Reinheit

≥ 80%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Dokumentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Ihre kürzlich angesehenen Produkte:

Online-Anfrage

Your information is safe with us. * Required Fields.

TrkA Protein, Human (Biotinylated, sf9, Flag, Avi)

 

Requested Quantity *

Name des Antragstellers *

 

Anrede

E-Mail-Addresse *

 

Telefonnummer *

Department

 

Name der Organisation *

City

Bundesland

Country or Region *

     

Bemerkungen

Massenanfrage

Inquiry Information

Produktname:
TrkA Protein, Human (Biotinylated, sf9, Flag, Avi)
Art. -Nr.:
HY-P702762
Menge:
MCE Japan Authorized Agent: