OSCAR Protein, Mouse (HEK293, Fc)
Based on 1 Customer Validation
OSCAR Protein is a crucial regulator of osteoclastogenesis, playing a significant role in osteoclast differentiation within the bone. OSCAR Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived OSCAR protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
OSCAR Protein is a crucial regulator of osteoclastogenesis, playing a significant role in osteoclast differentiation within the bone. OSCAR Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived OSCAR protein, expressed by HEK293 , with C-hFc labeled tag.
Background
OSCAR Protein is a crucial regulator of osteoclastogenesis and plays a significant role in osteoclast differentiation, specifically within the bone.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-hFc
-
Accession
Q8VBT3-1 (D19-N228)
-
Molecular Construction
-
N-term
-
OSCAR (D19-N228)
Accession # Q8VBT3-1 -
hFc
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
OSCAR; Osteoclast Associated Receptor OSCAR-S1; Osteoclast Associated Ig-Like Receptor; Osteoclast Associated Receptor OSCAR-S2; Osteoclast Associated, Immunoglobulin-Like Receptor; Osteoclast-Associated Receptor; Osteoclast-Associated Immunoglobulin-Like
-
AA Sequence
DFTPTAPLASYPQPWLGAHPAAVVTPGINVTLTCRAPQSAWRFALFKSGLVTPLLLRDVSVELAEFFLEEVTPAQGGSYHCRYRKTDWGPGVWSQPSNVLELLVTDQLPRPSLVALPGPVVAPGANVSLRCAGRIPGMSFALYRVGVATPLQYIDSVQPWADFLLIGTHTPGTYCCYYHTPSAPYVLSQRSQPLVISFEGSGSLDYTQGN
-
Predicted Molecular Mass
49.7 kDa
-
Molecular Weight
Approximately 60-70 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 8% trehalose is added as protectant before lyophilization.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
