OSCAR Protein, Mouse (HEK293, Fc)

OSCAR Protein is a crucial regulator of osteoclastogenesis, playing a significant role in osteoclast differentiation within the bone. OSCAR Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived OSCAR protein, expressed by HEK293 , with C-hFc labeled tag.

OSCAR Protein is a crucial regulator of osteoclastogenesis and plays a significant role in osteoclast differentiation, specifically within the bone.

Mouse

HEK293

C-hFc

Q8VBT3-1 (D19-N228)

232790  [NCBI]

Extracellular Domain

DFTPTAPLASYPQPWLGAHPAAVVTPGINVTLTCRAPQSAWRFALFKSGLVTPLLLRDVSVELAEFFLEEVTPAQGGSYHCRYRKTDWGPGVWSQPSNVLELLVTDQLPRPSLVALPGPVVAPGANVSLRCAGRIPGMSFALYRVGVATPLQYIDSVQPWADFLLIGTHTPGTYCCYYHTPSAPYVLSQRSQPLVISFEGSGSLDYTQGN

Approximately 60-70 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

≥ 95%, as determined by Bis-Tris PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 8% trehalose is added as protectant before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.