OX40 Ligand/TNFSF4 Protein, Mouse (HEK293, hFc)
The OX40 ligand/TNFSF4 protein is a cytokine that selectively binds to TNFRSF4 and serves as a key costimulator for T cell proliferation and cytokine production. As a homotrimer, this ligand plays a key role in modulating immune responses, particularly in enhancing T cell activation and function. OX40 Ligand/TNFSF4, Mouse (HEK293, hFc) is the recombinant mouse-derived OX40 Ligand/TNFSF4 protein, expressed by HEK293, with labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The OX40 ligand/TNFSF4 protein is a cytokine that selectively binds to TNFRSF4 and serves as a key costimulator for T cell proliferation and cytokine production. As a homotrimer, this ligand plays a key role in modulating immune responses, particularly in enhancing T cell activation and function. OX40 Ligand/TNFSF4, Mouse (HEK293, hFc) is the recombinant mouse-derived OX40 Ligand/TNFSF4 protein, expressed by HEK293, with labeled tag.
Background
OX40 Ligand/TNFSF4 protein, a cytokine, selectively binds to TNFRSF4, functioning as a critical co-stimulator for T-cell proliferation and cytokine production. Operating as a homotrimer, this ligand plays a key role in regulating immune responses, particularly in enhancing the activation and function of T-cells. Its engagement with TNFRSF4 highlights its significance as a molecular trigger for robust and targeted T-cell responses, contributing to the intricate orchestration of the immune system.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag N-hFc
-
Accession
P43488 (S51-L198)
-
Gene ID22164
-
Molecular Construction
-
N-term
-
hFc
-
TNFSF4 (S51-L198)
Accession # P43488 -
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
Tumor necrosis factor ligand superfamily member 4; OX40 ligand; OX40L; CD252; Tnfsf4; Ox40l; Txgp1l
-
AA Sequence
SSSPAKDPPIQRLRGAVTRCEDGQLFISSYKNEYQTMEVQNNSVVIKCDGLYIIYLKGSFFQEVKIDLHFREDHNPISIPMLNDGRRIVFTVVASLAFKDKVYLTVNAPDTLCEHLQINDGELIVVQLTPGYCAPEGSYHSTVNQVPL
-
Predicted Molecular Mass
42.6 kDa.
-
Molecular Weight
Approximately 52-56 kDa, based on Bis-Tris PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
