OX40/TNFRSF4 Protein, Human (HEK293, mFc)
OX40/TNFRSF4, a receptor for TNFSF4/OX40L/GP34, crucially acts as a costimulatory molecule in long-term T-cell immunity. Additionally, OX40 functions as a receptor for human herpesvirus 6B/HHV-6B during microbial infections, highlighting its dual role in the adaptive immune response and potential involvement in specific viral interactions. OX40/TNFRSF4 Protein, Human (HEK293, mFc) is the recombinant human-derived OX40/TNFRSF4 protein, expressed by HEK293, with C-mFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
OX40/TNFRSF4, a receptor for TNFSF4/OX40L/GP34, crucially acts as a costimulatory molecule in long-term T-cell immunity. Additionally, OX40 functions as a receptor for human herpesvirus 6B/HHV-6B during microbial infections, highlighting its dual role in the adaptive immune response and potential involvement in specific viral interactions. OX40/TNFRSF4 Protein, Human (HEK293, mFc) is the recombinant human-derived OX40/TNFRSF4 protein, expressed by HEK293, with C-mFc labeled tag.
Background
OX40, also known as TNFRSF4, functions as a receptor for TNFSF4/OX40L/GP34 and serves as a crucial costimulatory molecule implicated in long-term T-cell immunity. Beyond its role in immune regulation, OX40 also acts as a receptor for human herpesvirus 6B/HHV-6B during microbial infections. This dual functionality underscores OX40's significance in both the adaptive immune response and its potential involvement in specific viral interactions.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-mFc
-
Accession
P43489 (L29-A216)
-
Gene ID7293
-
Molecular Construction
-
N-term
-
OX40 (L29-A216)
Accession # P43489 -
mFc
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
TNFRSF4; CD134 Antigen; Prev. TXGP1L; Tumor Necrosis Factor Receptor Superfamily, Member 4; Tumor Necrosis Factor Receptor Superfamily Member 4; Lymphoid Activation Antigene ACT35; OX40L Receptor; OX40 Cell Surface Antigen; ACT35; OX40 Homologue; CD134; A
-
AA Sequence
LHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQNTVCRPCGPGFYNDVVSSKPCKPCTWCNLRSGSERKQLCTATQDTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSPGDNQACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQETQGPPARPITVQPTEAWPRTSQGPSTRPVEVPGGRAVA
-
Predicted Molecular Mass
47.1 kDa
-
Molecular Weight
Approximately 58-66 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Structure/Form
Monomer
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
