OX40/TNFRSF4 Protein, Cynomolgus/Rhesus Macaque (HEK293, His)

Customer Review

Based on 1 Customer Validation

OX40 (TNFRSF4), is a receptor for OX40 Ligand. OX40 is preferentially expressed by T cells. OX40 can be activated by OX40 Ligand, thereby functioning as a T cell co-stimulatory molecule. The OX40-OX40 Ligand interaction promotes effector T-cell survival and effectively induces memory T-cell generation, as well as enhances the helper function of Tfh for B cells, and also promotes the differentiation and maturation of DCs. OX40/TNFRSF4 Protein, Cynomolgus/Rhesus Macaque (HEK293, His) is a recombinant rhesus macaque OX40 with C-terminal His tag, which is produced in HEK293.

For research use only. We do not sell to patients.
  • Species: Rhesus Macaque; Cynomolgus
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

OX40 (TNFRSF4), is a receptor for OX40 Ligand. OX40 is preferentially expressed by T cells. OX40 can be activated by OX40 Ligand, thereby functioning as a T cell co-stimulatory molecule. The OX40-OX40 Ligand interaction promotes effector T-cell survival and effectively induces memory T-cell generation, as well as enhances the helper function of Tfh for B cells, and also promotes the differentiation and maturation of DCs[1][2]. OX40/TNFRSF4 Protein, Cynomolgus/Rhesus Macaque (HEK293, His) is a recombinant rhesus macaque OX40 with C-terminal His tag, which is produced in HEK293.

Background

OX40 (TNFRSF4), a member of TNFR superfamily, is a receptor for OX40 Ligand. OX40 is preferentially expressed by T cells, but also found in natural killer T cells, natural killer cells, neutrophils, and human airway smooth muscle cells. Human OX40 shares <30% aa sequence identity with mouse and rat. Mouse OX40 shares 90% aa sequence identity with rat[1].
OX40 Ligand can activate OX40 and thereby functioning as a T cell co-stimulatory molecule. The OX40-OX40 Ligand interaction promotes effector T-cell survival and effectively induces memory T-cell generation, as well as enhances the helper function of Tfh for B cells, and also promotes the differentiation and maturation of DCs[1][2].
The interaction between OX40 Ligand with OX40 is essential for the generation of antigen-specific memory T cells, and induces host antitumor immunity[3]. But the over-upregulation of OX40 and OX40L may induce abnormal activation of Tfh cells and excessive production of autoantibodies, which leads to autoimmune disease[1].

In Vitro

OX4 increases expression of RANTES protein in HUVECs[4].

Verified Bioactivity

Measured by its binding ability in a functional ELISA. When Recombinant Rhesus Macaque OX40 is immobilized at 2 μg/mL (100 μL/well), the concentration of Human OX40 Ligand that produces 50% of the optimal binding response is found to be approximately 1.369 ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA. When Recombinant Rhesus Macaque OX40 is immobilized at 2 μg/mL (100 μL/well), the concentration of Human OX40 Ligand that produces 50% of the optimal binding response is found to be approximately 1.369 ng/mL.

Technical Parameters

  • Species Rhesus Macaque; Cynomolgus
  • Source HEK293
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • OX40 (K28-A216)
      Accession # XP_001090870.1
    • His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    TNFRSF4; CD134 Antigen; Prev. TXGP1L; Tumor Necrosis Factor Receptor Superfamily, Member 4; Tumor Necrosis Factor Receptor Superfamily Member 4; Lymphoid Activation Antigene ACT35; OX40L Receptor; OX40 Cell Surface Antigen; ACT35; OX40 Homologue; CD134; A

  • AA Sequence

    KLHCVGDTYPSNDRCCQECRPGNGMVSRCNRSQNTVCRPCGPGFYNDVVSAKPCKACTWCNLRSGSERKQPCTATQDTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSPGDNQACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPPTQPQETQGPPARPTTVQPTEAWPRTSQRPSTRPVEVPRGPAVA

  • Predicted Molecular Mass

    20.4 kDa

  • Molecular Weight

    Approximately 42 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00