P-Selectin Protein, Human (HEK293, Fc)

P-selectin is a Ca(2+)-dependent receptor on myeloid cells that critically binds to sialic acid-Lewis X on neutrophils and monocytes, promoting the interaction between activated endothelial cells or platelets and leukocytes interaction. This binding primarily to SELPLG/PSGL1 and PODXL2 is critical for rapid rolling of leukocytes during early inflammation. P-Selectin Protein, Human (HEK293, Fc) is the recombinant human-derived P-Selectin protein, expressed by HEK293 , with C-hFc labeled tag.

P-selectin, a Ca(2+)-dependent receptor on myeloid cells, facilitates the binding to carbohydrates on neutrophils and monocytes, playing a crucial role in the interaction of activated endothelial cells or platelets with leukocytes. The ligand recognized by P-selectin is sialyl-Lewis X, and this interaction is pivotal for the rapid rolling of leukocytes over vascular surfaces during the initial stages of inflammation, accomplished through engagement with SELPLG. Additionally, P-selectin forms interactions with SNX17 and mediates adhesion and rolling of neutrophils through its association with SELPLG/PSGL1 and PODXL2. This interaction is contingent on the sialyl-Lewis X epitope of SELPLG and PODXL2, as well as the specific tyrosine sulfation on SELPLG.

Measured by the ability of the immobilized protein to support the adhesion of U937 human histiocytic lymphoma cells. When 5 x 10⁴ cells/well are added to SELP/Fc Chimera coated plates (10 μg/mL with 100 μL/well), > 80% cells will adhere after 1 hour at 37°C.

Human

HEK293

C-hFc

P16109 (W42-A771)

6403  [NCBI]

Extracellular Domain

WTYHYSTKAYSWNISRKYCQNRYTDLVAIQNKNEIDYLNKVLPYYSSYYWIGIRKNNKTWTWVGTKKALTNEAENWADNEPNNKRNNEDCVEIYIKSPSAPGKWNDEHCLKKKHALCYTASCQDMSCSKQGECLETIGNYTCSCYPGFYGPECEYVRECGELELPQHVLMNCSHPLGNFSFNSQCSFHCTDGYQVNGPSKLECLASGIWTNKPPQCLAAQCPPLKIPERGNMTCLHSAKAFQHQSSCSFSCEEGFALVGPEVVQCTASGVWTAPAPVCKAVQCQHLEAPSEGTMDCVHPLTAFAYGSSCKFECQPGYRVRGLDMLRCIDSGHWSAPLPTCEAISCEPLESPVHGSMDCSPSLRAFQYDTNCSFRCAEGFMLRGADIVRCDNLGQWTAPAPVCQALQCQDLPVPNEARVNCSHPFGAFRYQSVCSFTCNEGLLLVGASVLQCLATGNWNSVPPECQAIPCTPLLSPQNGTMTCVQPLGSSSYKSTCQFICDEGYSLSGPERLDCTRSGRWTDSPPMCEAIKCPELFAPEQGSLDCSDTRGEFNVGSTCHFSCDNGFKLEGPNNVECTTSGRWSATPPTCKGIASLPTPGVQCPALTTPGQGTMYCRHHPGTFGFNTTCYFGCNAGFTLIGDSTLSCRPSGQWTAVTPACRAVKCSELHVNKPIAMNCSNLWGNFSYGSICSFHCLEGQLLNGSAQTACQENGHWSTTVPTCQAGPLTIQEA

130-150 kDa

≥ 85%, as determined by reducing SDS-PAGE.

Solution

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.

• [1]. /biology-dictionary/huh-7-cell.html  [Content Brief]