PAM Protein, Human (HEK293, Fc)
Based on 1 Customer Validation
The PAM protein is a bifunctional enzyme that coordinates the α-amidation process, which is critical for the biosynthesis of neuropeptides and endocrine peptides. The peptidyl α-hydroxylating monooxygenase (PHM) domain hydroxylates the C-terminal glycine, and the peptidylglycine amide glycolate lyase (PAL) domain cleaves the NC-α bond, producing α-amidated peptides. PAM Protein, Human (HEK293, Fc) is the recombinant human-derived PAM protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The PAM protein is a bifunctional enzyme that coordinates the α-amidation process, which is critical for the biosynthesis of neuropeptides and endocrine peptides. The peptidyl α-hydroxylating monooxygenase (PHM) domain hydroxylates the C-terminal glycine, and the peptidylglycine amide glycolate lyase (PAL) domain cleaves the NC-α bond, producing α-amidated peptides. PAM Protein, Human (HEK293, Fc) is the recombinant human-derived PAM protein, expressed by HEK293 , with C-hFc labeled tag.
Background
The PAM protein operates as a bifunctional enzyme, overseeing the post-translational modification of inactive peptidylglycine precursors to their bioactive alpha-amidated peptide forms—a crucial terminal modification in the biosynthesis of numerous neural and endocrine peptides. The alpha-amidation process involves two sequential reactions, each governed by distinct catalytic domains within the enzyme. In the first step, the peptidyl alpha-hydroxylating monooxygenase (PHM) domain catalyzes a copper-, ascorbate-, and O2-dependent stereospecific hydroxylation (with S stereochemistry) at the alpha-carbon (C-alpha) of the C-terminal glycine of the peptidylglycine substrate. The subsequent step, orchestrated by the peptidylglycine amidoglycolate lyase (PAL) domain, entails a zinc-dependent cleavage of the N-C-alpha bond, resulting in the production of the alpha-amidated peptide and glyoxylate. Additionally, PAM exhibits a similar capacity to catalyze the two-step conversion of an N-fatty acylglycine to a primary fatty acid amide and glyoxylate in a manner reminiscent of its peptidylglycine modification function.
Verified Bioactivity
The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-hFc
-
Accession
P19021-2/NP_620176.1 (F21-V710)
-
Molecular Construction
-
N-term
-
PAM (F21-V710)
Accession # P19021-2/NP_620176.1 -
hFc
-
C-term
-
-
Protein Length
Partial
-
Synonyms
PAM; Peptidylglycine Alpha-Hydroxylating Monooxygenase; Peptidylglycine Alpha-Amidating Monooxygenase; Peptidyl-Glycine Alpha-Amidating Monooxygenase; PAM-1; Pancreatic Peptidylglycine Alpha-Amidating Monooxygenase; PAL; Peptidyl Alpha-Amidating Enzyme; P
-
AA Sequence
FRSPLSVFKRFKETTRPFSNECLGTTRPVVPIDSSDFALDIRMPGVTPKQSDTYFCMSMRIPVDEEAFVIDFKPRASMDTVHHMLLFGCNMPSSTGSYWFCDEGTCTDKANILYAWARNAPPTRLPKGVGFRVGGETGSKYFVLQVHYGDISAFRDNNKDCSGVSLHLTRLPQPLIAGMYLMMSVDTVIPAGEKVVNSDISCHYKNYPMHVFAYRVHTHHLGKVVSGYRVRNGQWTLIGRQSPQLPQAFYPVGHPVDVSFGDLLAARCVFTGEGRTEATHIGGTSSDEMCNLYIMYYMEAKHAVSFMTCTQNVAPDMFRTIPPEANIPIPVKSDMVMMHEHHKETEYKDKIPLLQQPKREEEEVLDQDFHMEEALDWPGVYLLPGQVSGVALDPKNNLVIFHRGDHVWDGNSFDSKFVYQQIGLGPIEEDTILVIDPNNAAVLQSSGKNLFYLPHGLSIDKDGNYWVTDVALHQVFKLDPNNKEGPVLILGRSMQPGSDQNHFCQPTDVAVDPGTGAIYVSDGYCNSRIVQFSPSGKFITQWGEESSGSSPLPGQFTVPHSLALVPLLGQLCVADRENGRIQCFKTDTKEFVREIKHSSFGRNVFAISYIPGLLFAVNGKPHFGDQEPVQGFVMNFSNGEIIDIFKPVRKHFDMPHDIVASEDGTVYIGDAHTNTVWKFTLTEKLEHRSV
-
Predicted Molecular Mass
103.3 kDa
-
Molecular Weight
Approximately 103 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (240 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)