PAP Protein, Human (His)

Customer Review

Based on 1 Customer Validation

PAP proteins play a dual regulatory role in cell growth, exhibiting different effects depending on the specific growth factors involved. In fibroblasts, it exerts a positive regulatory effect by enhancing PDGFA-stimulated cell growth. PAP Protein, Human (His) is the recombinant human-derived PAP protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

PAP proteins play a dual regulatory role in cell growth, exhibiting different effects depending on the specific growth factors involved. In fibroblasts, it exerts a positive regulatory effect by enhancing PDGFA-stimulated cell growth. PAP Protein, Human (His) is the recombinant human-derived PAP protein, expressed by E. coli , with N-6*His labeled tag.

Background

PAP protein plays a dual regulatory role in cell growth, demonstrating contrasting effects depending on the specific growth factor involved. In fibroblasts, it acts as a positive regulator by enhancing PDGFA-stimulated cell growth. However, simultaneously, it acts as a negative regulator by inhibiting the mitogenic effect of PDGFB. This protein exerts a fine-tuned control over cell growth, potentially influencing cellular responses to different growth factors and contributing to the overall balance and regulation of cell proliferation. The intricate interplay between PAP protein and growth factors like PDGFA and PDGFB highlights the complexity of cellular growth regulation and the importance of understanding the specific molecular mechanisms involved.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His
    • PAP (M1-K181)
      Accession # Q13442
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    PDAP1; 28 KDa Heat- And Acid-Stable Phosphoprotein; PDGFA Associated Protein 1; PDGF-Associated Protein; HASPP28; PDGFA-Associated Protein 1; PAP1; PDGF Associated Protein; PAP

  • AA Sequence

    MPKGGRKGGHKGRARQYTSPEEIDAQLQAEKQKAREEEEQKEGGDGAAGDPKKEKKSLDSDESEDEEDDYQQKRKGVEGLIDIENPNRVAQTTKKVTQLDLDGPKELSRREREEIEKQKAKERYMKMHLAGKTEQAKADLARLAIIRKQREEAARKKEEERKAKDDATLSGKRMQSLSLNK

  • Molecular Weight

    Approximately 30 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM Tris-HCl, 100 mM NaCl, 0.1 mM PMSF, 2 mM DTT, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00