PD-L2 Protein, Rat (HEK293, Fc)
Programmed cell death 1 ligand 2 (Pdcd1lg2, Pd-l2, B7-DC) is a member of B7 family and a ligand of programmed cell death 1. Pdcd1lg2 negatively regulates activated T cell proliferation, interferon-gamma production and interleukin-10 production in a PDCD1-independent manner, or inhibits T-cell proliferation by blocking cell cycle progression and cytokine production by interacts with PDCD1, and consequently causes cancer growth and suppresses the immune system. PD-L2 Protein, Rat (HEK293, Fc) is the recombinant rat-derived PD-L2 protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Rat
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Programmed cell death 1 ligand 2 (Pdcd1lg2, Pd-l2, B7-DC) is a member of B7 family and a ligand of programmed cell death 1. Pdcd1lg2 negatively regulates activated T cell proliferation, interferon-gamma production and interleukin-10 production in a PDCD1-independent manner, or inhibits T-cell proliferation by blocking cell cycle progression and cytokine production by interacts with PDCD1, and consequently causes cancer growth and suppresses the immune system. PD-L2 Protein, Rat (HEK293, Fc) is the recombinant rat-derived PD-L2 protein, expressed by HEK293 , with C-hFc labeled tag.
Background
Programmed cell death 1 ligand 2 (Pdcd1lg2, Pd-l2, B7-DC) is a member of B7 family and a ligand of programmed cell death 1. Pdcd1lg2 is consist of one IgV and one IgC domain, and is involved in the costimulatory signal, negatively regulates activated T cell proliferation, interferon-gamma production and interleukin-10 production in a PDCD1-independent manner. Interaction of Pdcd1lg2 with PDCD1 inhibits T-cell proliferation by blocking cell cycle progression and cytokine production. The interaction of Pdcd1lg2 with PD-1 boosts tolerance of T-cells, induces an inhibitory effect on T-cell activation/proliferation, increases the conversion of T helper cells into Foxp3+ Treg cells, and prevents cytolysis of T cell in cancerous cells, and consequently causes cancer growth and suppresses the immune system. Pdcd1lg2 expresses chiefly on APCs such as non-hematopoietic tissues, myeloid dendritic cells, and macrophages, while Pdcd1lg is active in external side of plasma membrane and is a biomarker of pulmonary tuberculosis[1][2][3][4].
Technical Parameters
-
Species Rat
-
Source HEK293
-
Tag C-hFc
-
Accession
D4AAV6 (L20-R219)
-
Molecular Construction
-
N-term
-
PD-L2 (L20-R219)
Accession # D4AAV6 -
hFc
-
C-term
-
-
Protein Length
Partial
-
Synonyms
PDCD1LG2; B7 Dendritic Cell Molecule; Programmed Cell Death 1 Ligand 2; Programmed Death Ligand 2; PD-L2; Butyrophilin B7-DC; CD273; PDCD1 Ligand 2; B7-DC; PDCD1L2; PDL2; PD-1-Ligand 2; B7DC; CD273 Antigen; BA574F11.2; PD-1 Ligand 2; Btdc
-
AA Sequence
LFTVTAPKEVYTVDFGSSVSLECDFDRRECTELEGIRASLQKVENDTSSQSQRATLLEELLPLGKASFHIPSVQVRDSGQYRCLVICGAAWDYKYLTVKVKASYVRIDTGILEVPGTGEVQLICQARGYPLAEVSWQNVSVPANTSHIRTPEGLYQVTSVLRLKPQPNRNFSCMFWNAHMKELTSAIIDPLSWMEPKVPR
-
Predicted Molecular Mass
49.2 kDa
-
Molecular Weight
Approximately 65 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
