PDE9A Protein, Human (His)
PDE9A is a phosphodiesterase that uniquely hydrolyzes second messengers with unparalleled specificity, particularly in the regulation of natriuretic peptide-dependent signaling in the heart, which is critical for the control of cardiac hypertrophy. Its specificity rules out effects on nitric oxide-dependent signaling in the heart. PDE9A Protein, Human (His) is the recombinant human-derived PDE9A protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
PDE9A is a phosphodiesterase that uniquely hydrolyzes second messengers with unparalleled specificity, particularly in the regulation of natriuretic peptide-dependent signaling in the heart, which is critical for the control of cardiac hypertrophy. Its specificity rules out effects on nitric oxide-dependent signaling in the heart. PDE9A Protein, Human (His) is the recombinant human-derived PDE9A protein, expressed by E. coli , with N-His labeled tag.
Background
PDE9A, a phosphodiesterase enzyme, exhibits remarkable specificity by hydrolyzing the second messenger cwith the highest affinity and selectivity compared to other members of the cyclic nucleotide phosphodiesterase family. Its distinctive role is evident in regulating natriuretic-peptide-dependent csignaling in the heart, where it serves as a key regulator of cardiac hypertrophy in myocytes and muscle. Notably, PDE9A does not influence nitric oxide-dependent csignaling in the heart, highlighting its specificity for natriuretic-peptide-dependent pathways. Further investigations are warranted to determine whether its role in hydrolyzing natriuretic-peptide-dependent cis exclusive to the heart or represents a broader feature of the protein. Additionally, in the brain, PDE9A contributes to cognitive functions such as learning and long-term memory, emphasizing its diverse physiological roles in different tissues.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His
-
Accession
O76083-2 (P181-K506)
-
Molecular Construction
-
N-term
-
His
-
PDE9A (P181-K506)
Accession # O76083-2 -
C-term
-
-
Protein Length
Partial
-
Synonyms
PDE9A; Phosphodiesterase PDE9A21; Phosphodiesterase 9A; Phosphodiesterase; High Affinity CGMP-Specific 3',5'-Cyclic Phosphodiesterase 9A; HSPDE9A2; CGMP-Specific 3',5'-Cyclic Phosphodiesterase Type 9
-
AA Sequence
PTYPKYLLSPETIEALRKPTFDVWLWEPNEMLSCLEHMYHDLGLVRDFSINPVTLRRWLFCVHDNYRNNPFHNFRHCFCVAQMMYSMVWLCSLQEKFSQTDILILMTAAICHDLDHPGYNNTYQINARTELAVRYNDISPLENHHCAVAFQILAEPECNIFSNIPPDGFKQIRQGMITLILATDMARHAEIMDSFKEKMENFDYSNEEHMTLLKMILIKCCDISNEVRPMEVAEPWVDCLLEEYFMQSDREKSEGLPVAPFMDRDKVTKATAQIGFIKFVLIPMFETVTKLFPMVEEIMLQPLWESRDRYEELKRIDDAMKELQKK
-
Predicted Molecular Mass
40 kDa
-
Molecular Weight
Approximately 37 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)