1. Recombinant Proteins
  2. Enzymes & Regulators
  3. PDE9A Protein, Human (His)

PDE9A is a phosphodiesterase that uniquely hydrolyzes second messengers with unparalleled specificity, particularly in the regulation of natriuretic peptide-dependent signaling in the heart, which is critical for the control of cardiac hypertrophy. Its specificity rules out effects on nitric oxide-dependent signaling in the heart. PDE9A Protein, Human (His) is the recombinant human-derived PDE9A protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PDE9A is a phosphodiesterase that uniquely hydrolyzes second messengers with unparalleled specificity, particularly in the regulation of natriuretic peptide-dependent signaling in the heart, which is critical for the control of cardiac hypertrophy. Its specificity rules out effects on nitric oxide-dependent signaling in the heart. PDE9A Protein, Human (His) is the recombinant human-derived PDE9A protein, expressed by E. coli , with N-His labeled tag.

Background

PDE9A, a phosphodiesterase enzyme, exhibits remarkable specificity by hydrolyzing the second messenger cwith the highest affinity and selectivity compared to other members of the cyclic nucleotide phosphodiesterase family. Its distinctive role is evident in regulating natriuretic-peptide-dependent csignaling in the heart, where it serves as a key regulator of cardiac hypertrophy in myocytes and muscle. Notably, PDE9A does not influence nitric oxide-dependent csignaling in the heart, highlighting its specificity for natriuretic-peptide-dependent pathways. Further investigations are warranted to determine whether its role in hydrolyzing natriuretic-peptide-dependent cis exclusive to the heart or represents a broader feature of the protein. Additionally, in the brain, PDE9A contributes to cognitive functions such as learning and long-term memory, emphasizing its diverse physiological roles in different tissues.

Species

Human

Source

E. coli

Tag

N-His

Accession

O76083-2 (P181-K506)

Gene ID
Molecular Construction
N-term
His
PDE9A (P181-K506)
Accession # O76083-2
C-term
Protein Length

Partial

Synonyms
High affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A; PDE9A
AA Sequence

PTYPKYLLSPETIEALRKPTFDVWLWEPNEMLSCLEHMYHDLGLVRDFSINPVTLRRWLFCVHDNYRNNPFHNFRHCFCVAQMMYSMVWLCSLQEKFSQTDILILMTAAICHDLDHPGYNNTYQINARTELAVRYNDISPLENHHCAVAFQILAEPECNIFSNIPPDGFKQIRQGMITLILATDMARHAEIMDSFKEKMENFDYSNEEHMTLLKMILIKCCDISNEVRPMEVAEPWVDCLLEEYFMQSDREKSEGLPVAPFMDRDKVTKATAQIGFIKFVLIPMFETVTKLFPMVEEIMLQPLWESRDRYEELKRIDDAMKELQKK

Predicted Molecular Mass
40 kDa
Molecular Weight

Approximately 37 kDa,based on SDS-PAGE under reducing conditions.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

PDE9A Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

PDE9A Protein, Human (His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PDE9A Protein, Human (His)
Cat. No.:
HY-P75963
Quantity:
MCE Japan Authorized Agent: