PEX11A Protein, Human (HEK293, Fc)
The PEX11A protein may regulate peroxisome dynamics, affecting peroxisome proliferation and division by promoting the association of coating proteins with the peroxisomal membrane. PEX11A is associated with structural organization and promotes membrane protrusion and elongation at the peroxisomal surface. PEX11A Protein, Human (HEK293, Fc) is the recombinant human-derived PEX11A protein, expressed by HEK293 , with N-mFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The PEX11A protein may regulate peroxisome dynamics, affecting peroxisome proliferation and division by promoting the association of coating proteins with the peroxisomal membrane. PEX11A is associated with structural organization and promotes membrane protrusion and elongation at the peroxisomal surface. PEX11A Protein, Human (HEK293, Fc) is the recombinant human-derived PEX11A protein, expressed by HEK293 , with N-mFc labeled tag.
Background
PEX11A Protein emerges as a potential regulator in peroxisomal dynamics, playing a role in peroxisomal proliferation and contributing to the regulation of peroxisome division. It may facilitate the binding of coatomer proteins to the peroxisomal membrane, suggesting involvement in the structural organization of these cellular organelles. Additionally, PEX11A is implicated in promoting membrane protrusion and elongation on the peroxisomal surface. Existing as a homodimer and forming a heterodimer with PEX11G, PEX11A likely engages in complex interactions to influence peroxisomal functions. Potential interactions with COPB2, COPA, PEX19, and FIS1 further underscore the intricate network of associations in which PEX11A is involved, hinting at its multifaceted role in peroxisomal biology. Delving deeper into the specific mechanisms governing PEX11A's contributions to peroxisomal dynamics could provide valuable insights into its role in cellular homeostasis and metabolism.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag N-mFc
-
Accession
O75192 (R106-P219)
-
Molecular Construction
-
N-term
-
mFc
-
PEX11A (R106-P219)
Accession # O75192 -
C-term
-
-
Protein Length
Lumenal Domain
-
Synonyms
PEX11A; MGC119947; Peroxisomal Biogenesis Factor 11 Alpha; MGC138534; Peroxisomal Biogenesis Factor 11A; HsPEX11p; PMP28; CDNA FLJ10553 Fis, Clone NT2RP2002325, Highly Similar To Peroxisomal Membrane Protein 11A; Peroxisomal Membrane Protein 11A; PEX11A P
-
AA Sequence
RSVGLTSGINKEKWRTRAAHHYYYSLLLSLVRDLYEISLQMKRVTCDRAKKEKSASQDPLWFSVAEEETEWLQSFLLLLFRSLKQHPPLLLDTVKNLCDILNPLDQLGIYKSNP
-
Predicted Molecular Mass
40 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
