1. Recombinant Proteins
  2. Others
  3. PEX11A Protein, Human (HEK293, Fc)

The PEX11A protein may regulate peroxisome dynamics, affecting peroxisome proliferation and division by promoting the association of coating proteins with the peroxisomal membrane. PEX11A is associated with structural organization and promotes membrane protrusion and elongation at the peroxisomal surface. PEX11A Protein, Human (HEK293, Fc) is the recombinant human-derived PEX11A protein, expressed by HEK293 , with N-mFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The PEX11A protein may regulate peroxisome dynamics, affecting peroxisome proliferation and division by promoting the association of coating proteins with the peroxisomal membrane. PEX11A is associated with structural organization and promotes membrane protrusion and elongation at the peroxisomal surface. PEX11A Protein, Human (HEK293, Fc) is the recombinant human-derived PEX11A protein, expressed by HEK293 , with N-mFc labeled tag.

Background

PEX11A Protein emerges as a potential regulator in peroxisomal dynamics, playing a role in peroxisomal proliferation and contributing to the regulation of peroxisome division. It may facilitate the binding of coatomer proteins to the peroxisomal membrane, suggesting involvement in the structural organization of these cellular organelles. Additionally, PEX11A is implicated in promoting membrane protrusion and elongation on the peroxisomal surface. Existing as a homodimer and forming a heterodimer with PEX11G, PEX11A likely engages in complex interactions to influence peroxisomal functions. Potential interactions with COPB2, COPA, PEX19, and FIS1 further underscore the intricate network of associations in which PEX11A is involved, hinting at its multifaceted role in peroxisomal biology. Delving deeper into the specific mechanisms governing PEX11A's contributions to peroxisomal dynamics could provide valuable insights into its role in cellular homeostasis and metabolism.

Species

Human

Source

HEK293

Tag

N-mFc

Accession

O75192 (R106-P219)

Gene ID
Molecular Construction
N-term
mFc
PEX11A (R106-P219)
Accession # O75192
C-term
Protein Length

Partial

Synonyms
Peroxisomal membrane protein 11A; PMP28; Peroxin-11A; PEX11
AA Sequence

RSVGLTSGINKEKWRTRAAHHYYYSLLLSLVRDLYEISLQMKRVTCDRAKKEKSASQDPLWFSVAEEETEWLQSFLLLLFRSLKQHPPLLLDTVKNLCDILNPLDQLGIYKSNP

Predicted Molecular Mass
40 kDa
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

PEX11A Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

PEX11A Protein, Human (HEK293, Fc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PEX11A Protein, Human (HEK293, Fc)
Cat. No.:
HY-P77133
Quantity:
MCE Japan Authorized Agent: