PF-4/CXCL4 Protein, Human (solution)
Based on 1 Customer Validation
PF-4/CXCL4 is a member of the CXC chemokine family that is released from the alpha-granules of activated platelets. PF-4/CXCL4 binds with high affinity to heparin, with antiheparin, antiangiogenic and immunomodulatory activities. PF-4/CXCL4 plays a role in hematopoiesis and immune cell modulation. PF-4/CXCL4 Protein, Human (solution) is produced in E. coli , and consists of 70 amino acids (E32-S101).
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
PF-4/CXCL4 is a member of the CXC chemokine family that is released from the alpha-granules of activated platelets. PF-4/CXCL4 binds with high affinity to heparin, with antiheparin, antiangiogenic and immunomodulatory activities. PF-4/CXCL4 plays a role in hematopoiesis and immune cell modulation[1][2]. PF-4/CXCL4 Protein, Human (solution) is produced in E. coli , and consists of 70 amino acids (E32-S101).
CXCL4, also known as PF-4 (platelet factor-4), is a member of the CXC chemokine family produced by cells of the megakaryocytic lineage. In megakaryocytes CXCL4 is synthesized, enclosed in vesicles, and transferred to the α granules from which it is secreted following platelet activation. CXCL4 expression is also found in microglia, monocytes and activated T-cells[1][2].
Mature human CXCL4 shares 70% amino acid sequence identity with mouse and rat CXCL4.
CXCL4 is stored in secretory granules of blood platelets and is released in response to protein kinase C and Rac1 activation. Platelets are considered to be the major cellular source of CXCL4. In the α-granules of blood platelets CXCL4 is kept as a tetramer bound to two molecules of chondroitin sulphate. CXCL4 does not possess an ELR acid sequence at its amino terminus and therefore does not bind to CXCR1 or CXCR2. CXCL4 moderates the effects of heparin-like molecules on the endothelial cell surface of blood vessels, thereby inhibiting local antithrombin III activity, which results in a procoagulant role of CXCL4. CXCL4 exhibits antiangiogenic properties in vitro and in vivo and inhibits tumor neovascularization through a variety of mechanisms. First, CXCL4 is able to interact directly with angiogenic growth factors, such as FGFs and VEGF, and inhibits their interaction with the cell surface receptor. Second, CXCL4 may bind proteoglycans and interfere with the proteoglycan-bystander effect on growth factor activity. Furthermore, a cell surface receptor that is expressed by human endothelial cells (ECs) in a cell cycle-dependent manner11 and mediates the antiangiogenic effects of CXCL4 has been recently identified and named as CXCR3-B. CXCL4 has been shown to modulate the proliferation, phenotype and function of immune cells. For instance, CXCL4 has been reported to promote monocyte survival and macrophage activation. CXCL4 induces migration of activated T lymphocytes[1][2][3].
CXCL4 shows pleiotropic biological functions. Firstly, CXCL4 activates platelets, modulates platelet aggregation and stimulates release of α-granule proteins. CXCL4 has a role in heparin-induced thrombocytopenia (HIT). Secondly, CXCL4 inhibits endothelial cell proliferation and migration, leading to suppression of angiogenesis. Thirdly, CXCL4 expresses immunomodulatory activities, such as down-regulation of IFN- production by type 1 T-helper (Th1) cells and up-regulation of IL-4, IL-5, and IL-13 in type 2 T-helper (Th2) cells. Fourthly, CXCL4 influences hematopoiesis, inhibiting megakaryocytopoiesis and the proliferation of committed erythroid and granulocyte-macrophage colonies, as well as of primitive CD34+ progenitors. Moreover, CXCL4 is also highly upregulated in plasmacytoid dendritic cells (pDCs) in systemic sclerosis and dendritic cells (DCs) after severe trauma[1][2][3].
Recombinant human CXCL4 (1 μg/mL; for 6 days) treatment monocytes differentiating into dendritic cells (moDCs) induces a higher IL-17 production by CD4+ T cells. CXCL4 treatment also increases the percentage of IFN-γ-producing cells and the percentage of co-expressing IL17+IL-22+ cells. CXCL4-treated moDCs also significantly potentiates CD4+ T cell proliferation[4].
Recombinant human CXCL4/PF-4 (8 μg/ml) affects the production of cytokines by human Th1 and Th2 cell lines, in particular, it down-regulated the Th1 cytokine IFN-γ and increased the mRNA levels of Th2 cytokines IL-4, IL-5 and IL-13[5].
Measured by its ability to inhibit bFGF-dependent proliferation of human umbilical vein endothelial cells (HUVEC). The ED50 for this effect is typically 1-5 μg/mL in the presence of 5 ng/mL bFGF.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
P02776 (E32-S101)
-
Molecular Construction
-
N-term
-
CXCL4 (E32-S101)
Accession # P02776 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
PF4; C-X-C Motif Chemokine 4; Platelet Factor 4; Oncostatin-A; SCYB4; Iroplact; CXCL4; PF-4; Chemokine (C-X-C Motif) Ligand 4
-
AA Sequence
EAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES
-
Predicted Molecular Mass
7.8 kDa
-
Molecular Weight
Approximately 5-10 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (264 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
[1]. Lasagni L, et al. PF-4/CXCL4 and CXCL4L1 exhibit distinct subcellular localization and a differentially regulated mechanism of secretion. Blood. 2007 May 15;109(10):4127-34. [Content Brief]
[2]. Pieter Ruytinx, et al. CXCL4 and CXCL4L1 in cancer. Cytokine. 2018 Sep;109:65-71. [Content Brief]
[3]. Gabriele Domschke, et al. CXCL4-induced macrophages in human atherosclerosis. Cytokine. 2019 Oct;122:154141. [Content Brief]
[4]. Alsya J Affandi, et al. CXCL4 is a novel inducer of human Th17 cells and correlates with IL-17 and IL-22 in psoriatic arthritis. Eur J Immunol. 2018 Mar;48(3):522-531. [Content Brief]
[5]. Jo Vandercappellen, et al. The role of the CXC chemokines platelet factor-4 (CXCL4/PF-4) and its variant (CXCL4L1/PF-4var) in inflammation, angiogenesis and cancer. Cytokine Growth Factor Rev. 2011 Feb;22(1):1-18. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)