PGD2 Synthase/PTGDS Protein, Mouse (HEK293, His)
Based on 1 Customer Validation
PGD2 Synthase/PTGDS Protein, an enzyme, is involved in the synthesis of prostaglandin D2 (PGD2). Dysregulation of PGD2 Synthase/PTGDS Protein has been linked to allergic diseases and inflammation. Targeting PGD2 Synthase/PTGDS Protein may provide potential therapeutic interventions in these conditions by modulating PGD2 levels, reducing allergic responses, and managing inflammation-related disorders. PGD2 Synthase/PTGDS Protein, Mouse (HEK293, His) is the recombinant mouse-derived PGD2 Synthase/PTGDS protein, expressed by HEK293 , with C-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
PGD2 Synthase/PTGDS Protein, an enzyme, is involved in the synthesis of prostaglandin D2 (PGD2). Dysregulation of PGD2 Synthase/PTGDS Protein has been linked to allergic diseases and inflammation. Targeting PGD2 Synthase/PTGDS Protein may provide potential therapeutic interventions in these conditions by modulating PGD2 levels, reducing allergic responses, and managing inflammation-related disorders. PGD2 Synthase/PTGDS Protein, Mouse (HEK293, His) is the recombinant mouse-derived PGD2 Synthase/PTGDS protein, expressed by HEK293 , with C-His labeled tag.
Background
The PGD2 Synthase/PTGDS protein serves as a catalyst for the conversion of PGH2 to PGD2, a prostaglandin that plays a crucial role in smooth muscle contraction/relaxation and acts as a potent inhibitor of platelet aggregation. It is implicated in various central nervous system (CNS) functions, including sedation, NREM sleep, PGE2-induced allodynia, and potentially acts as an anti-apoptotic factor in oligodendrocytes. Additionally, this protein binds to small non-substrate lipophilic molecules such as biliverdin, bilirubin, retinal, retinoic acid, and thyroid hormone, potentially functioning as a scavenger for harmful hydrophobic compounds and acting as a secretory transporter for retinoids and thyroid hormones. It is likely involved in the development and maintenance of the blood-brain, blood-retina, blood-aqueous humor, and blood-testis barriers. Furthermore, it plays significant roles in the maturation and maintenance of the central nervous system and male reproductive system. It is also engaged in the maturation of mast cells through its involvement in the PLA2G3-dependent pathway, where PLA2G3 secreted by immature mast cells acts on neighboring fibroblasts upstream of PTGDS, leading to the synthesis of PGD2, which ultimately promotes mast cell maturation and degranulation via PTGDR.
Verified Bioactivity
Measured by its ability to catalyse the conversion of PGH2 to PGD2. The specific activity is 4.878 pg/min/µg that incubate at 25 ºC for 1 minutes.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-6*His
-
Accession
NP_032989.2 (Q25-E189)
-
Molecular Construction
-
N-term
-
PGD2 Synthase/PTGDS (Q25-E189)
Accession # NP_032989.2 -
His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
PTGDS; PGD2 Synthase; Prostaglandin D2 Synthase; Cerebrin-28; L-PGDS; PGDS2; PGDS; PDS; Glutathione-Independent PGD Synthase; Testis Tissue Sperm-Binding Protein Li 63n; Prostaglandin-H2 D-Isomerase; Prostaglandin D2 Synthase (21kD, Brain); Lipocalin-Type
-
AA Sequence
QGHDTVQPNFQQDKFLGRWYSAGLASNSSWFREKKAVLYMCKTVVAPSTEGGLNLTSTFLRKNQCETKIMVLQPAGAPGHYTYSSPHSGSIHSVSVVEANYDEYALLFSRGTKGPGQDFRMATLYSRTQTLKDELKEKFTTFSKAQGLTEEDIVFLPQPDKCIQE
-
Molecular Weight
Approximately 26-32 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)