PGD2 Synthase/PTGDS Protein, Mouse (HEK293, His)

Customer Review

Based on 1 Customer Validation

PGD2 Synthase/PTGDS Protein, an enzyme, is involved in the synthesis of prostaglandin D2 (PGD2). Dysregulation of PGD2 Synthase/PTGDS Protein has been linked to allergic diseases and inflammation. Targeting PGD2 Synthase/PTGDS Protein may provide potential therapeutic interventions in these conditions by modulating PGD2 levels, reducing allergic responses, and managing inflammation-related disorders. PGD2 Synthase/PTGDS Protein, Mouse (HEK293, His) is the recombinant mouse-derived PGD2 Synthase/PTGDS protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

PGD2 Synthase/PTGDS Protein, an enzyme, is involved in the synthesis of prostaglandin D2 (PGD2). Dysregulation of PGD2 Synthase/PTGDS Protein has been linked to allergic diseases and inflammation. Targeting PGD2 Synthase/PTGDS Protein may provide potential therapeutic interventions in these conditions by modulating PGD2 levels, reducing allergic responses, and managing inflammation-related disorders. PGD2 Synthase/PTGDS Protein, Mouse (HEK293, His) is the recombinant mouse-derived PGD2 Synthase/PTGDS protein, expressed by HEK293 , with C-His labeled tag.

Background

The PGD2 Synthase/PTGDS protein serves as a catalyst for the conversion of PGH2 to PGD2, a prostaglandin that plays a crucial role in smooth muscle contraction/relaxation and acts as a potent inhibitor of platelet aggregation. It is implicated in various central nervous system (CNS) functions, including sedation, NREM sleep, PGE2-induced allodynia, and potentially acts as an anti-apoptotic factor in oligodendrocytes. Additionally, this protein binds to small non-substrate lipophilic molecules such as biliverdin, bilirubin, retinal, retinoic acid, and thyroid hormone, potentially functioning as a scavenger for harmful hydrophobic compounds and acting as a secretory transporter for retinoids and thyroid hormones. It is likely involved in the development and maintenance of the blood-brain, blood-retina, blood-aqueous humor, and blood-testis barriers. Furthermore, it plays significant roles in the maturation and maintenance of the central nervous system and male reproductive system. It is also engaged in the maturation of mast cells through its involvement in the PLA2G3-dependent pathway, where PLA2G3 secreted by immature mast cells acts on neighboring fibroblasts upstream of PTGDS, leading to the synthesis of PGD2, which ultimately promotes mast cell maturation and degranulation via PTGDR.

Verified Bioactivity

Measured by its ability to catalyse the conversion of PGH2 to PGD2. The specific activity is 4.878 pg/min/µg that incubate at 25 ºC for 1 minutes.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • PGD2 Synthase/PTGDS (Q25-E189)
      Accession # NP_032989.2
    • His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    PTGDS; PGD2 Synthase; Prostaglandin D2 Synthase; Cerebrin-28; L-PGDS; PGDS2; PGDS; PDS; Glutathione-Independent PGD Synthase; Testis Tissue Sperm-Binding Protein Li 63n; Prostaglandin-H2 D-Isomerase; Prostaglandin D2 Synthase (21kD, Brain); Lipocalin-Type

  • AA Sequence

    QGHDTVQPNFQQDKFLGRWYSAGLASNSSWFREKKAVLYMCKTVVAPSTEGGLNLTSTFLRKNQCETKIMVLQPAGAPGHYTYSSPHSGSIHSVSVVEANYDEYALLFSRGTKGPGQDFRMATLYSRTQTLKDELKEKFTTFSKAQGLTEEDIVFLPQPDKCIQE

  • Molecular Weight

    Approximately 26-32 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00