PLA2G2D Protein, Mouse (HEK293, Fc)
Based on 1 Customer Validation
PLA2G2D protein is a secreted calcium-dependent phospholipase A2 that targets extracellular lipids and has anti-inflammatory and immunosuppressive functions.It hydrolyzes the fatty acyl group at the sn-2 position, preferentially hydrolyzing phosphatidylethanolamine and phosphatidylglycerol.PLA2G2D Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived PLA2G2D protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
PLA2G2D protein is a secreted calcium-dependent phospholipase A2 that targets extracellular lipids and has anti-inflammatory and immunosuppressive functions.It hydrolyzes the fatty acyl group at the sn-2 position, preferentially hydrolyzing phosphatidylethanolamine and phosphatidylglycerol.PLA2G2D Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived PLA2G2D protein, expressed by HEK293 , with C-hFc labeled tag.
Background
PLA2G2D Protein is a secretory calcium-dependent phospholipase A2 that primarily targets extracellular lipids, exerting anti-inflammatory and immunosuppressive functions. It hydrolyzes the ester bond of the fatty acyl group attached at the sn-2 position of phospholipids, with a preference for phosphatidylethanolamines and phosphatidylglycerols over phosphatidylcholines. In draining lymph nodes, it selectively hydrolyzes diacyl and alkenyl forms of phosphatidylethanolamines, releasing omega-3 polyunsaturated fatty acids (PUFAs) such as eicosapentaenoate and docosahexaenoate, which are precursors of the anti-inflammatory lipid mediators known as resolvins. During the resolution phase of acute inflammation, PLA2G2D Protein drives the synthesis of resolvin D1 derived from docosahexaenoate, which suppresses dendritic cell activation and T-helper 1 immune response. In addition to its catalytic activity, PLA2G2D Protein promotes the differentiation of regulatory T cells (Tregs) and participates in the maintenance of immune tolerance. It may also contribute to lipid remodeling of cellular membranes and the generation of lipid mediators involved in pathogen clearance. Moreover, PLA2G2D Protein displays bactericidal activity against Gram-positive bacteria by directly hydrolyzing phospholipids of the bacterial membrane.
Verified Bioactivity
Measured by its ability to hydrolyze 20 μΜ 1-Hexadecanoyl-2-(1-pyrene-decanoyl)-sn-glycero-3-phosphocholine. The specific activity is 23.007-39.63 pmol/min/μg that at room temperature in kinetic mode for 5 minutes.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-hFc
-
Accession
Q9WVF6-1 (G20-C144)
-
Molecular Construction
-
N-term
-
PLA2G2D (G20-C144)
Accession # Q9WVF6 -
hFc
-
C-term
-
-
Protein Length
Full Length of Isoform-1 Mature Protein
-
Synonyms
PLA2G2D; GIID SPLA2; Phospholipase A2 Group IID; SPLA2-IID; SPLA2S; PLA2IID; Secretory-Type PLA, Stroma-Associated Homolog; SPLASH; Phosphatidylcholine 2-Acylhydrolase 2D; Phospholipase A2, Group IID; Group IID Secretory Phospholipase A2; Secretory Phosph
-
AA Sequence
GLLNLNKMVTHMTGKKAFFSYWPYGCHCGLGGKGQPKDATDWCCQKHDCCYAHLKIDGCKSLTDNYKYSISQGTIQCSDNGSWCERQLCACDKEVALCLKQNLDSYNKRLRYYWRPRCKGKTPAC
-
Molecular Weight
Approximately 40-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 10% glycerol, 8% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)