PLA2G2D Protein, Mouse (HEK293, Fc)

Customer Review

Based on 1 Customer Validation

PLA2G2D protein is a secreted calcium-dependent phospholipase A2 that targets extracellular lipids and has anti-inflammatory and immunosuppressive functions.It hydrolyzes the fatty acyl group at the sn-2 position, preferentially hydrolyzing phosphatidylethanolamine and phosphatidylglycerol.PLA2G2D Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived PLA2G2D protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

PLA2G2D protein is a secreted calcium-dependent phospholipase A2 that targets extracellular lipids and has anti-inflammatory and immunosuppressive functions.It hydrolyzes the fatty acyl group at the sn-2 position, preferentially hydrolyzing phosphatidylethanolamine and phosphatidylglycerol.PLA2G2D Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived PLA2G2D protein, expressed by HEK293 , with C-hFc labeled tag.

Background

PLA2G2D Protein is a secretory calcium-dependent phospholipase A2 that primarily targets extracellular lipids, exerting anti-inflammatory and immunosuppressive functions. It hydrolyzes the ester bond of the fatty acyl group attached at the sn-2 position of phospholipids, with a preference for phosphatidylethanolamines and phosphatidylglycerols over phosphatidylcholines. In draining lymph nodes, it selectively hydrolyzes diacyl and alkenyl forms of phosphatidylethanolamines, releasing omega-3 polyunsaturated fatty acids (PUFAs) such as eicosapentaenoate and docosahexaenoate, which are precursors of the anti-inflammatory lipid mediators known as resolvins. During the resolution phase of acute inflammation, PLA2G2D Protein drives the synthesis of resolvin D1 derived from docosahexaenoate, which suppresses dendritic cell activation and T-helper 1 immune response. In addition to its catalytic activity, PLA2G2D Protein promotes the differentiation of regulatory T cells (Tregs) and participates in the maintenance of immune tolerance. It may also contribute to lipid remodeling of cellular membranes and the generation of lipid mediators involved in pathogen clearance. Moreover, PLA2G2D Protein displays bactericidal activity against Gram-positive bacteria by directly hydrolyzing phospholipids of the bacterial membrane.

Verified Bioactivity

Measured by its ability to hydrolyze 20 μΜ 1-Hexadecanoyl-2-(1-pyrene-decanoyl)-sn-glycero-3-phosphocholine. The specific activity is 23.007-39.63 pmol/min/μg that at room temperature in kinetic mode for 5 minutes.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-hFc
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • PLA2G2D (G20-C144)
      Accession # Q9WVF6
    • hFc
    • C-term
  • Protein Length

    Full Length of Isoform-1 Mature Protein

  • Synonyms

    PLA2G2D; GIID SPLA2; Phospholipase A2 Group IID; SPLA2-IID; SPLA2S; PLA2IID; Secretory-Type PLA, Stroma-Associated Homolog; SPLASH; Phosphatidylcholine 2-Acylhydrolase 2D; Phospholipase A2, Group IID; Group IID Secretory Phospholipase A2; Secretory Phosph

  • AA Sequence

    GLLNLNKMVTHMTGKKAFFSYWPYGCHCGLGGKGQPKDATDWCCQKHDCCYAHLKIDGCKSLTDNYKYSISQGTIQCSDNGSWCERQLCACDKEVALCLKQNLDSYNKRLRYYWRPRCKGKTPAC

  • Molecular Weight

    Approximately 40-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 10% glycerol, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00