PLA2G7 Protein, Mouse (sf9, His, Myc)
The PLA2G7 protein is a lipoprotein-associated calcium-independent phospholipase A2 that plays a key role in phospholipid catabolism during inflammation and oxidative stress responses.It acts at the lipid-water interface and hydrolyzes the ester bond of the fatty acyl group at the sn-2 position, with particular preference for short-chain fatty acyl groups.PLA2G7 Protein, Mouse (sf9, His, Myc) is the recombinant mouse-derived PLA2G7 protein, expressed by sf9 insect cells , with C-Myc, N-10*His labeled tag.
- Species: Mouse
- Source: Sf9 insect cells
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The PLA2G7 protein is a lipoprotein-associated calcium-independent phospholipase A2 that plays a key role in phospholipid catabolism during inflammation and oxidative stress responses.It acts at the lipid-water interface and hydrolyzes the ester bond of the fatty acyl group at the sn-2 position, with particular preference for short-chain fatty acyl groups.PLA2G7 Protein, Mouse (sf9, His, Myc) is the recombinant mouse-derived PLA2G7 protein, expressed by sf9 insect cells , with C-Myc, N-10*His labeled tag.
Background
PLA2G7 protein, a lipoprotein-associated calcium-independent phospholipase A2, plays a pivotal role in phospholipid catabolism during inflammatory and oxidative stress responses. Operating at the lipid-aqueous interface, it hydrolyzes the ester bond of fatty acyl groups at the sn-2 position of phospholipids, with a specific preference for those carrying short-chain fatty acyl groups. Additionally, PLA2G7 can target phospholipids with long fatty acyl chains if they bear oxidized functional groups. The enzyme's versatility extends to inactivating platelet-activating factor (PAF), a potent pro-inflammatory signaling lipid, and hydrolyzing oxidatively truncated phospholipids, preventing their accumulation and uncontrolled pro-inflammatory effects. When associated with high-density lipoprotein (HDL) particles, PLA2G7 contributes to the hydrolysis of phospholipids containing long-chain fatty acyl hydroperoxides, safeguarding against potential oxylipin accumulation in the vascular wall. Furthermore, PLA2G7 catalyzes the release of F2-isoprostanes, serving as lipid biomarkers for cellular oxidative damage.
Technical Parameters
-
Species Mouse
-
Source Sf9 insect cells
-
Tag C-Myc;N-10*His
-
Accession
Q60963 (F22-N440)
-
Molecular Construction
-
N-term
-
10*His
-
PLA2G7 (F22-N440)
Accession # Q60963 -
Myc
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
PLA2G7; LDL-Associated Phospholipase A2; Phospholipase A2 Group VII; Group-VIIA Phospholipase A2; PAFAH; PAF 2-Acylhydrolase; LDL-PLA2; PAF Acetylhydrolase; Lp-PLA2; LDL-PLA(2); Phospholipase A2, Group VII (Platelet-Activating Factor Acetylhydrolase, Plas
-
AA Sequence
FHWQDTSSFDFRPSVMFHKLQSVMSAAGSGHSKIPKGNGSYPVGCTDLMFGYGNESVFVRLYYPAQDQGRLDTVWIPNKEYFLGLSIFLGTPSIVGNILHLLYGSLTTPASWNSPLRTGEKYPLIVFSHGLGAFRTIYSAIGIGLASNGFIVATVEHRDRSASATYFFEDQVAAKVENRSWLYLRKVKQEESESVRKEQVQQRAIECSRALSAILDIEHGDPKENVLGSAFDMKQLKDAIDETKIALMGHSFGGATVLQALSEDQRFRCGVALDPWMYPVNEELYSRTLQPLLFINSAKFQTPKDIAKMKKFYQPDKERKMITIKGSVHQNFDDFTFVTGKIIGNKLTLKGEIDSRVAIDLTNKASMAFLQKHLGLQKDFDQWDPLVEGDDENLIPGSPFDAVTQVPAQQHSPGSQTQN
-
Predicted Molecular Mass
50.7 kDa
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)