Pleckstrin Protein, Human (His)
Pleckstrin Protein serves as a primary substrate for protein kinase C in platelets. Pleckstrin Protein, Human (His) is the recombinant human-derived Pleckstrin protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Pleckstrin Protein serves as a primary substrate for protein kinase C in platelets. Pleckstrin Protein, Human (His) is the recombinant human-derived Pleckstrin protein, expressed by E. coli , with N-His labeled tag.
Pleckstrin stands out as a major substrate for protein kinase C within platelets.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His
-
Accession
P08567 (M1-K350)
-
Molecular Construction
-
N-term
-
His
-
Pleckstrin (M1-K350)
Accession # P08567 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
PLEK; PLEK1; Pleckstrin; Platelet 47 KDa Protein; P47
-
AA Sequence
MEPKRIREGYLVKKGSVFNTWKPMWVVLLEDGIEFYKKKSDNSPKGMIPLKGSTLTSPCQDFGKRMFVFKITTTKQQDHFFQAAFLEERDAWVRDIKKAIKCIEGGQKFARKSTRRSIRLPETIDLGALYLSMKDTEKGIKELNLEKDKKIFNHCFTGNCVIDWLVSNQSVRNRQEGLMIASSLLNEGYLQPAGDMSKSAVDGTAENPFLDNPDAFYYFPDSGFFCEENSSDDDVILKEEFRGVIIKQGCLLKQGHRRKNWKVRKFILREDPAYLHYYDPAGAEDPLGAIHLRGCVVTSVESNSNGRKSEEENLFEIITADEVHYFLQAATPKERTEWIRAIQMASRTGK
-
Predicted Molecular Mass
41.9 kDa
-
Molecular Weight
Approximately 45 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
