PLGF Protein, Mouse (HEK293, Fc)
PLGF protein is an important growth factor in angiogenesis and endothelial cell growth, stimulating cell proliferation and migration by binding to the FLT1/VEGFR-1 receptor.PLGF plays a crucial role in angiogenesis and also contributes to tumor growth, highlighting its involvement in pathological angiogenesis.PLGF Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived PLGF protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
PLGF protein is an important growth factor in angiogenesis and endothelial cell growth, stimulating cell proliferation and migration by binding to the FLT1/VEGFR-1 receptor.PLGF plays a crucial role in angiogenesis and also contributes to tumor growth, highlighting its involvement in pathological angiogenesis.PLGF Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived PLGF protein, expressed by HEK293 , with C-hFc labeled tag.
Background
The PLGF Protein, a growth factor integral to angiogenesis and endothelial cell growth, exhibits stimulatory effects on both proliferation and migration of these cells. Functioning through its binding to the FLT1/VEGFR-1 receptor, PLGF plays a crucial role in orchestrating angiogenic processes. Additionally, it contributes to tumor growth, emphasizing its involvement in pathological angiogenesis. Structurally, PLGF exists as an antiparallel homodimer, connected by disulfide linkages. Furthermore, it can form heterodimers with VEGFA/VEGF, suggesting a dynamic role in the regulation of vascular growth and function. The multifaceted actions and structural arrangements of PLGF underscore its significance in modulating vascular processes and tumor development.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-hFc
-
Accession
P49764 (V19-P158)
-
Molecular Construction
-
N-term
-
PLGF (V19-P158)
Accession # P49764 -
hFc
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
PGF; PlGF-2; Prev. PGFL; Placental Growth Factor, Vascular Endothelial Growth Factor-Related Protein; PLGF; Placental Growth Factor, Vascular Endothelial Growth Factor-Related Protein, Isoform CRA_a; Placenta Growth Factor; Placental Growth Factor-Like; S
-
AA Sequence
VHSQGALSAGNNSTEVEVVPFNEVWGRSYCRPMEKLVYILDEYPDEVSHIFSPSCVLLSRCSGCCGDEGLHCVPIKTANITMQILKIPPNRDPHFYVEMTFSQDVLCECRPILETTKAERRKTKGKRKRSRNSQTEEPHP
-
Predicted Molecular Mass
42.4 kDa
-
Molecular Weight
Approximately 55-65 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
