1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. VEGF & VEGFR
  4. VEGF
  5. PLGF
  6. PLGF Protein, Mouse (HEK293, Fc)

PLGF protein is an important growth factor in angiogenesis and endothelial cell growth, stimulating cell proliferation and migration by binding to the FLT1/VEGFR-1 receptor.PLGF plays a crucial role in angiogenesis and also contributes to tumor growth, highlighting its involvement in pathological angiogenesis.PLGF Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived PLGF protein, expressed by HEK293 , with C-hFc labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고
20 μg Ask For Quote & Lead Time
50 μg Ask For Quote & Lead Time
100 μg Ask For Quote & Lead Time

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

PLGF protein is an important growth factor in angiogenesis and endothelial cell growth, stimulating cell proliferation and migration by binding to the FLT1/VEGFR-1 receptor.PLGF plays a crucial role in angiogenesis and also contributes to tumor growth, highlighting its involvement in pathological angiogenesis.PLGF Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived PLGF protein, expressed by HEK293 , with C-hFc labeled tag.

Background

The PLGF Protein, a growth factor integral to angiogenesis and endothelial cell growth, exhibits stimulatory effects on both proliferation and migration of these cells. Functioning through its binding to the FLT1/VEGFR-1 receptor, PLGF plays a crucial role in orchestrating angiogenic processes. Additionally, it contributes to tumor growth, emphasizing its involvement in pathological angiogenesis. Structurally, PLGF exists as an antiparallel homodimer, connected by disulfide linkages. Furthermore, it can form heterodimers with VEGFA/VEGF, suggesting a dynamic role in the regulation of vascular growth and function. The multifaceted actions and structural arrangements of PLGF underscore its significance in modulating vascular processes and tumor development.

Species

Mouse

Source

HEK293

Tag

C-hFc

Accession

P49764 (V19-P158)

Gene ID
Molecular Construction
N-term
PLGF (V19-P158)
Accession # P49764
hFc
C-term
Protein Length

Full Length of Mature Protein

Synonyms
PlGF; PGF; PGFL; SHGC-10760; D12S1900; PlGF-2
AA Sequence

VHSQGALSAGNNSTEVEVVPFNEVWGRSYCRPMEKLVYILDEYPDEVSHIFSPSCVLLSRCSGCCGDEGLHCVPIKTANITMQILKIPPNRDPHFYVEMTFSQDVLCECRPILETTKAERRKTKGKRKRSRNSQTEEPHP

Predicted Molecular Mass
42.4 kDa
분자량

Approximately 55-65 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity

≥ 95%, as determined by Bis-Tris PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

각종 서류

PLGF Protein, Mouse (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

PLGF Protein, Mouse (HEK293, Fc)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
PLGF Protein, Mouse (HEK293, Fc)
Cat. No.:
HY-P78337
수량:
MCE Japan Authorized Agent: