PODXL Protein, Human (P.pastoris, His)

Customer Review

Based on 1 Customer Validation

PODXL proteins coordinate multiple cellular functions, acting as anti-adhesion and pro-adhesion molecules. In podocytes, it maintains open filtration pathways through charge repulsion and promotes migration and cell-cell contacts in an integrin-dependent manner. PODXL Protein, Human (P.pastoris, His) is the recombinant human-derived PODXL protein, expressed by P. pastoris , with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: P. pastoris
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

PODXL proteins coordinate multiple cellular functions, acting as anti-adhesion and pro-adhesion molecules. In podocytes, it maintains open filtration pathways through charge repulsion and promotes migration and cell-cell contacts in an integrin-dependent manner. PODXL Protein, Human (P.pastoris, His) is the recombinant human-derived PODXL protein, expressed by P. pastoris , with N-His labeled tag.

Background

The PODXL Protein plays a multifaceted role in the regulation of adhesion, cell morphology, and cancer progression. Functioning as an anti-adhesive molecule, PODXL maintains an open filtration pathway between neighboring foot processes in the podocyte through charge repulsion. Simultaneously, it acts as a pro-adhesive molecule, enhancing cell adherence to immobilized ligands, promoting migration, and facilitating cell-cell contacts in an integrin-dependent manner. PODXL induces the formation of apical actin-dependent microvilli and is crucial for the establishment of initial epithelial polarization and apical lumen formation during renal tubulogenesis. In cancer, PODXL contributes to cell migration and invasion by interacting with the actin-binding protein EZR, affecting EZR-dependent signaling events that lead to increased activities of the MAPK and PI3K pathways. Its oligomeric state varies, existing as a monomer when associated with membrane rafts and forming oligomers when integrated into the apical membrane. PODXL's interactions with NHERF1, NHERF2, and EZR highlight its dynamic role in cellular processes and its importance in diverse cellular contexts.

Technical Parameters

  • Species Human
  • Source P. pastoris
  • Tag N-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • His
    • PODXL (Q32-F458)
      Accession # O00592-1
    • C-term
  • Protein Length

    Partial Extracellular Domain

  • Synonyms

    PODXL; Gp135; Podocalyxin Like; PDX; Gp200; GCTM-2 Antigen; PCLP; PCLP-1; PC; Podocalyxin-Like, Isoform CRA_b; Podocalyxin-Like Protein 1; Podocalyxin-Like; Podocalyxin; PCLP1; PODXL1

  • AA Sequence

    QNATQTTTDSSNKTAPTPASSVTIMATDTAQQSTVPTSKANEILASVKATTLGVSSDSPGTTTLAQQVSGPVNTTVARGGGSGNPTTTIESPKSTKSADTTTVATSTATAKPNTTSSQNGAEDTTNSGGKSSHSVTTDLTSTKAEHLTTPHPTSPLSPRQPTSTHPVATPTSSGHDHLMKISSSSSTVAIPGYTFTSPGMTTTLLETVFHHVSQAGLELLTSGDLPTLASQSAGITASSVISQRTQQTSSQMPASSTAPSSQETVQPTSPATALRTPTLPETMSSSPTAASTTHRYPKTPSPTVAHESNWAKCEDLETQTQSEKQLVLNLTGNTLCAGGASDEKLISLICRAVKATFNPAQDKCGIRLASVPGSQTVVVKEITIHTKLPAKDVYERLKDKWDELKEAGVSDMKLGDQGPPEEAEDRF

  • Predicted Molecular Mass

    46.2 kDa

  • Molecular Weight

    Approximately 120 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.15 M NaCl, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00