PODXL Protein, Human (P.pastoris, His)

PODXL proteins coordinate multiple cellular functions, acting as anti-adhesion and pro-adhesion molecules. In podocytes, it maintains open filtration pathways through charge repulsion and promotes migration and cell-cell contacts in an integrin-dependent manner. PODXL Protein, Human (P.pastoris, His) is the recombinant human-derived PODXL protein, expressed by P. pastoris , with N-His labeled tag.

The PODXL Protein plays a multifaceted role in the regulation of adhesion, cell morphology, and cancer progression. Functioning as an anti-adhesive molecule, PODXL maintains an open filtration pathway between neighboring foot processes in the podocyte through charge repulsion. Simultaneously, it acts as a pro-adhesive molecule, enhancing cell adherence to immobilized ligands, promoting migration, and facilitating cell-cell contacts in an integrin-dependent manner. PODXL induces the formation of apical actin-dependent microvilli and is crucial for the establishment of initial epithelial polarization and apical lumen formation during renal tubulogenesis. In cancer, PODXL contributes to cell migration and invasion by interacting with the actin-binding protein EZR, affecting EZR-dependent signaling events that lead to increased activities of the MAPK and PI3K pathways. Its oligomeric state varies, existing as a monomer when associated with membrane rafts and forming oligomers when integrated into the apical membrane. PODXL's interactions with NHERF1, NHERF2, and EZR highlight its dynamic role in cellular processes and its importance in diverse cellular contexts.

Human

P. pastoris

N-His

O00592-1 (Q32-F458)

5420  [NCBI]

Partial

QNATQTTTDSSNKTAPTPASSVTIMATDTAQQSTVPTSKANEILASVKATTLGVSSDSPGTTTLAQQVSGPVNTTVARGGGSGNPTTTIESPKSTKSADTTTVATSTATAKPNTTSSQNGAEDTTNSGGKSSHSVTTDLTSTKAEHLTTPHPTSPLSPRQPTSTHPVATPTSSGHDHLMKISSSSSTVAIPGYTFTSPGMTTTLLETVFHHVSQAGLELLTSGDLPTLASQSAGITASSVISQRTQQTSSQMPASSTAPSSQETVQPTSPATALRTPTLPETMSSSPTAASTTHRYPKTPSPTVAHESNWAKCEDLETQTQSEKQLVLNLTGNTLCAGGASDEKLISLICRAVKATFNPAQDKCGIRLASVPGSQTVVVKEITIHTKLPAKDVYERLKDKWDELKEAGVSDMKLGDQGPPEEAEDRF

Approximately 120 kDa

≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.15 M NaCl, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.