PRDC/GREM2 Protein, Mouse
Based on 1 Customer Validation
PRDC, encoded by the GREM2 gene, has multiple functions, including BMP and protein binding, which are critical for dorsal identity determination, embryoid body morphogenesis, and signal transduction regulation. PRDC is found extracellularly and is expressed in structures such as the cartilaginous skull, integument, intestinal smooth muscle annulus, lung, and neural tube. PRDC/GREM2 Protein, Mouse is the recombinant mouse-derived PRDC/GREM2 protein, expressed by E. coli , with tag free.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
PRDC, encoded by the GREM2 gene, has multiple functions, including BMP and protein binding, which are critical for dorsal identity determination, embryoid body morphogenesis, and signal transduction regulation. PRDC is found extracellularly and is expressed in structures such as the cartilaginous skull, integument, intestinal smooth muscle annulus, lung, and neural tube. PRDC/GREM2 Protein, Mouse is the recombinant mouse-derived PRDC/GREM2 protein, expressed by E. coli , with tag free.
PRDC, represented by the GREM2 gene, is a versatile protein with a spectrum of functions, including BMP binding activity, heparin binding activity, and identical protein binding activity. This protein plays crucial roles in various processes such as the determination of dorsal identity, embryonic body morphogenesis, and the regulation of signal transduction. Found in the extracellular space, PRDC is expressed in diverse structures like the chondrocranium, integument, intestine smooth muscle circular layer, lung, and neural tube. The human orthologs of this gene are implicated in tooth agenesis, emphasizing its significance in developmental processes. The broad expression pattern across multiple tissues, including the ovary and lung, underscores the widespread influence of PRDC in various physiological contexts.
Measured by its ability to inhibit BMP-4-induced alkaline phosphatase production by MC3T3-E1 mouse preosteoblast cells. The ED50 for this effect is 0.04067 μg/mL in the presence of 50 ng/mL of Recombinant Human BMP-4, corresponding to a specific activity is 2.46×104units/mg.
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag Tag Free
-
Accession
O88273/NP_035955 (R22-Q168)
-
Molecular Construction
-
N-term
-
PRDC (R22-Q168)
Accession # O88273/NP_035955 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
GREM2; Gremlin-2; Gremlin 2, DAN Family BMP Antagonist; FLJ21195; CKTSF1B2; Gremlin 2, Cysteine Knot Superfamily, Homolog (Xenopus Laevis); DAND3; Gremlin 2, Cysteine Knot Superfamily, Homolog; Protein Related To DAN And Cerberus; Gremlin 2; Prdc; STHAG9;
-
AA Sequence
RKNRPAGAIPSPYKDGSSNNSERWHHQIKEVLASSQEALVVTERKYLKSDWCKTQPLRQTVSEEGCRSRTILNRFCYGQCNSFYIPRHVKKEEDSFQSCAFCKPQRVTSVIVELECPGLDPPFRIKKIQKVKHCRCMSVNLSDSDKQ
-
Molecular Weight
Approximately 18 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 0.01% TFA, 30% Acetonitrile, pH 4.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
