1. Recombinant Proteins
  2. CD Antigens
  3. Epithelial cell CD Proteins
  4. PRNP/CD230
  5. PRNP/CD230 Protein, Human (HEK293, Fc, solution)

PRNP/CD230 Protein, Human (HEK293, Fc, solution)

Cat. No.: HY-P74619
Handling Instructions Technical Support

Although its primary function is unknown, the PRNP/CD230 protein has been implicated in multiple neuronal processes, including neuronal development, synaptic plasticity, and myelin homeostasis. PRNP acts as an agonist of the ADGRG6 receptor and promotes the maintenance of myelin. PRNP/CD230 Protein, Human (HEK293, Fc, solution) is the recombinant human-derived PRNP/CD230 protein, expressed by HEK293 , with C-hFc labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
10 μg 해외재고보유
50 μg 해외재고보유
100 μg 견적 받기
> 100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

Although its primary function is unknown, the PRNP/CD230 protein has been implicated in multiple neuronal processes, including neuronal development, synaptic plasticity, and myelin homeostasis. PRNP acts as an agonist of the ADGRG6 receptor and promotes the maintenance of myelin. PRNP/CD230 Protein, Human (HEK293, Fc, solution) is the recombinant human-derived PRNP/CD230 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

PRNP/CD230, while its primary physiological function remains unclear, is implicated in various neuronal processes, including neuronal development and synaptic plasticity. Additionally, it may play a crucial role in maintaining the myelin sheath of neurons and promoting myelin homeostasis by acting as an agonist for the ADGRG6 receptor. The protein's involvement in iron uptake and homeostasis further underscores its multifaceted functions. Soluble oligomers of PRNP exhibit toxicity to neuroblastoma cells, inducing apoptosis in vitro. Association with GPC1, facilitated by heparan sulfate chains, targets PRNP to lipid rafts and contributes to Cu(2+) or Zn(2+) availability for the ascorbate-mediated GPC1 deaminase degradation of its heparan sulfate side chains. PRNP exists both as a monomer and homodimer, with a propensity to aggregate into amyloid fibrils, possibly influenced by copper binding. Notably, PRNP interacts with various proteins, including GRB2, APP, ERI3/PRNPIP, SYN1, and ADGRG6, suggesting a complex network of molecular interactions.

Biological Activity

Measured by its ability to inhibit proliferation of SH-SY5Y cells. The ED50 for this effect is 0.123 μg/mL, corresponding to a specific activity is 8.137×10^3 units/mg.

  • Measured by its ability to inhibit proliferation of SH-SY5Y cells. The ED50 for this effect is 0.123 μg/mL, corresponding to a specific activity is 8.137×103 units/mg.
Species

Human

Source

HEK293

Tag

C-hFc

Accession

P04156/NP_000302.1 (K23-G229)

Gene ID
Molecular Construction
N-term
PRNP (K23-G229)
Accession # P04156/NP_000302.1
hFc
C-term
Protein Length

Partial

Synonyms
Major prion protein; CD230; ALTPRP; PRIP; PRP
AA Sequence

KKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQGGGTHSQWNKPSKPKTNMKHMAGAAAAGAVVGGLGGYMLGSAMSRPIIHFGSDYEDRYYRENMHRYPNQVYYRPMDEYSNQNNFVHDCVNITIKQHTVTTTTKGENFTETDVKMMERVVEQMCITQYERESQAYYQRG

분자량

Approximately 57.4 kDa

Glycosylation
Yes
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

선적

Shipping with dry ice.

각종 서류

PRNP/CD230 Protein, Human (HEK293, Fc, solution) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

PRNP/CD230 Protein, Human (HEK293, Fc, solution)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
PRNP/CD230 Protein, Human (HEK293, Fc, solution)
Cat. No.:
HY-P74619
수량:
MCE Japan Authorized Agent: