1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Peptide Hormone & Neuropeptides
  4. Prolactin
  5. Prolactin Protein, Human (Biotinylated, HEK293, Fc-Avi)

Prolactin Protein, Human (Biotinylated, HEK293, Fc-Avi)

Cat. No.: HY-P78820
Handling Instructions Technical Support

The Prolactin Protein, a vital somatotropin/prolactin family member, regulates physiological processes, including growth and lactation. Its study enhances understanding of endocrine regulation, with therapeutic applications. Classification within the family underscores unique mechanisms and signaling pathways. Further exploration promises insights into Prolactin's contributions to normal physiology and pathological conditions. Prolactin Protein, Human (Biotinylated, HEK293, Fc-Avi) is the recombinant human-derived Prolactin protein, expressed by HEK293 , with C-Avi, C-hFc labeled tag. The total length of Prolactin Protein, Human (Biotinylated, HEK293, Fc-Avi) is 199 a.a., with molecular weight of 57-66 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
25 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
200 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
> 200 μg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The Prolactin Protein, a vital somatotropin/prolactin family member, regulates physiological processes, including growth and lactation. Its study enhances understanding of endocrine regulation, with therapeutic applications. Classification within the family underscores unique mechanisms and signaling pathways. Further exploration promises insights into Prolactin's contributions to normal physiology and pathological conditions. Prolactin Protein, Human (Biotinylated, HEK293, Fc-Avi) is the recombinant human-derived Prolactin protein, expressed by HEK293 , with C-Avi, C-hFc labeled tag. The total length of Prolactin Protein, Human (Biotinylated, HEK293, Fc-Avi) is 199 a.a., with molecular weight of 57-66 kDa.

Background

The Prolactin Protein is an essential member of the somatotropin/prolactin family, underlining its crucial role in regulating various physiological processes. As part of this family, Prolactin likely shares conserved structural and functional features with related proteins, emphasizing its involvement in growth and lactation. The classification within the somatotropin/prolactin family underscores its specific designation within the broader context of hormones, offering insights into its unique mechanisms and signaling pathways. The study of Prolactin contributes to our understanding of its role in endocrine regulation, providing potential applications in therapeutic interventions and a deeper comprehension of its broader impact on cellular processes involved in reproductive and metabolic functions. Further exploration of Prolactin's role holds promise for enhancing our knowledge of its contributions to both normal physiology and pathological conditions.

Biological Activity

Immobilized Human Prolactin R Fc at 5 μg/mL (100 μL/well) can bind Biotinylated Human Prolactin Fc-Avi with a linear range of 5-156 ng/mL.

Species

Human

Source

HEK293

Tag

C-Avi;C-hFc

Accession

Q5THQ0 (L29-C227)

Gene ID
Protein Length

Full Length of Mature Protein

Conjugation

Biotin

Synonyms
PRL; Prolactin
AA Sequence

LPICPGGAARCQVTLRDLFDRAVVLSHYIHNLSSEMFSEFDKRYTHGRGFITKAINSCHTSSLATPEDKEQAQQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSGLPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNNC

Molecular Weight

57-66 kDa

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized a 0.22 μm filtered solution of Tris with Glycine, Arginine and NaCl, pH 7.5. Normally trehalose is added as protectant before lyophilization.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Prolactin Protein, Human (Biotinylated, HEK293, Fc-Avi) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Prolactin Protein, Human (Biotinylated, HEK293, Fc-Avi)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Prolactin Protein, Human (Biotinylated, HEK293, Fc-Avi)
Cat. No.:
HY-P78820
Quantity:
MCE Japan Authorized Agent: