Prolactin Protein, Human (Biotinylated, HEK293, Fc-Avi)
The Prolactin Protein, a vital somatotropin/prolactin family member, regulates physiological processes, including growth and lactation. Its study enhances understanding of endocrine regulation, with therapeutic applications. Classification within the family underscores unique mechanisms and signaling pathways. Further exploration promises insights into Prolactin's contributions to normal physiology and pathological conditions. Prolactin Protein, Human (Biotinylated, HEK293, Fc-Avi) is the recombinant human-derived Prolactin protein, expressed by HEK293 , with C-Avi, C-hFc labeled tag. The total length of Prolactin Protein, Human (Biotinylated, HEK293, Fc-Avi) is 199 a.a., with molecular weight of 57-66 kDa.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The Prolactin Protein, a vital somatotropin/prolactin family member, regulates physiological processes, including growth and lactation. Its study enhances understanding of endocrine regulation, with therapeutic applications. Classification within the family underscores unique mechanisms and signaling pathways. Further exploration promises insights into Prolactin's contributions to normal physiology and pathological conditions. Prolactin Protein, Human (Biotinylated, HEK293, Fc-Avi) is the recombinant human-derived Prolactin protein, expressed by HEK293 , with C-Avi, C-hFc labeled tag. The total length of Prolactin Protein, Human (Biotinylated, HEK293, Fc-Avi) is 199 a.a., with molecular weight of 57-66 kDa.
Background
The Prolactin Protein is an essential member of the somatotropin/prolactin family, underlining its crucial role in regulating various physiological processes. As part of this family, Prolactin likely shares conserved structural and functional features with related proteins, emphasizing its involvement in growth and lactation. The classification within the somatotropin/prolactin family underscores its specific designation within the broader context of hormones, offering insights into its unique mechanisms and signaling pathways. The study of Prolactin contributes to our understanding of its role in endocrine regulation, providing potential applications in therapeutic interventions and a deeper comprehension of its broader impact on cellular processes involved in reproductive and metabolic functions. Further exploration of Prolactin's role holds promise for enhancing our knowledge of its contributions to both normal physiology and pathological conditions.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-Avi;C-hFc
-
Accession
Q5THQ0 (L29-C227)
-
Protein Length
Full Length of Mature Protein
-
Conjugation
Biotin
-
Synonyms
PRL; PPRL; Prolactin; GHA1; Luteotropic Hormone; Decidual Prolactin; Prolactin Peptide; Growth Hormone A1; Luteotropin
-
AA Sequence
LPICPGGAARCQVTLRDLFDRAVVLSHYIHNLSSEMFSEFDKRYTHGRGFITKAINSCHTSSLATPEDKEQAQQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSGLPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNNC
-
Predicted Molecular Mass
51.2 kDa
-
Molecular Weight
Approximately 57-66 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
