Prostasin/PRSS8 Protein, Rat (HEK293, His)
Based on 1 Customer Validation
Prostasin/PRSS8 Protein, featuring trypsin-like cleavage specificity, crucially activates the epithelial sodium channel (ENaC) by cleaving gamma subunits (SCNN1G) and modulating ion transport. Structurally, it forms a disulfide bond-linked heterodimer with light and heavy chains, highlighting its intricate role in cellular responses. Prostasin/PRSS8 Protein, Rat (HEK293, His) is the recombinant rat-derived Prostasin/PRSS8 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Rat
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Prostasin/PRSS8 Protein, featuring trypsin-like cleavage specificity, crucially activates the epithelial sodium channel (ENaC) by cleaving gamma subunits (SCNN1G) and modulating ion transport. Structurally, it forms a disulfide bond-linked heterodimer with light and heavy chains, highlighting its intricate role in cellular responses. Prostasin/PRSS8 Protein, Rat (HEK293, His) is the recombinant rat-derived Prostasin/PRSS8 protein, expressed by HEK293 , with C-His labeled tag.
Background
Prostasin/PRSS8, characterized by a trypsin-like cleavage specificity with a preference for poly-basic substrates, plays a crucial role in stimulating the activity of the epithelial sodium channel (ENaC). Its activation involves the cleavage of the gamma subunits (SCNN1G) to modulate ion transport processes. Structurally, Prostasin/PRSS8 forms a heterodimer comprising light and heavy chains, united by a disulfide bond, underscoring its functional complexity in mediating cellular responses.
Verified Bioactivity
Measured by its ability to cleave the fluorogenic peptide substrate Boc-QAR-AMC. The specific activity is 31.804 pmoL/min/µg, as measured under the described conditions.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Rat
-
Source HEK293
-
Tag C-His
-
Accession
Q9ES87 (A30-R322)
-
Molecular Construction
-
N-term
-
Prostasin (A30-R322)
Accession # Q9ES87 -
His
-
C-term
-
-
Protein Length
Full Length of Prostasin chain (with Propeptide)
-
Synonyms
PRSS8; Channel-Activating Serine Protease 1; Serine Protease 8; Channel-Activating Protease 1; CAP1; Protease, Serine 8; Prostasin
-
AA Sequence
ADGTEASCGAVIQPRITGGGSAKPGQWPWQVSITYNGVHVCGGSLVSNQWVVSAAHCFPREHSKEEYEVKLGAHQLDSFSNDIVVHTVAQIISHSSYREEGSQGDIALIRLSSPVTFSRYIRPICLPAANASFPNGLHCTVTGWGHVAPSVSLQTPRPLQQLEVPLISRETCSCLYNINAVPEEPHTIQQDMLCAGYVKGGKDACQGDSGGPLSCPIDGLWYLAGIVSWGDACGAPNRPGVYTLTSTYASWIHHHVAELQPRVVPQTQESQPDGHLCNHHPVFNLAAAQKLSR
-
Molecular Weight
Approximately 32.9 kDa.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
