1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. Prostasin/PRSS8 Protein, Rat (HEK293, His)

Prostasin/PRSS8 Protein, featuring trypsin-like cleavage specificity, crucially activates the epithelial sodium channel (ENaC) by cleaving gamma subunits (SCNN1G) and modulating ion transport. Structurally, it forms a disulfide bond-linked heterodimer with light and heavy chains, highlighting its intricate role in cellular responses. Prostasin/PRSS8 Protein, Rat (HEK293, His) is the recombinant rat-derived Prostasin/PRSS8 protein, expressed by HEK293 , with C-His labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
무료 샘플   Apply now
무료 샘플   Apply now
5 μg 해외재고보유
10 μg 해외재고보유
50 μg 해외재고보유
100 μg 해외재고보유
> 100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

Prostasin/PRSS8 Protein, featuring trypsin-like cleavage specificity, crucially activates the epithelial sodium channel (ENaC) by cleaving gamma subunits (SCNN1G) and modulating ion transport. Structurally, it forms a disulfide bond-linked heterodimer with light and heavy chains, highlighting its intricate role in cellular responses. Prostasin/PRSS8 Protein, Rat (HEK293, His) is the recombinant rat-derived Prostasin/PRSS8 protein, expressed by HEK293 , with C-His labeled tag.

Background

Prostasin/PRSS8, characterized by a trypsin-like cleavage specificity with a preference for poly-basic substrates, plays a crucial role in stimulating the activity of the epithelial sodium channel (ENaC). Its activation involves the cleavage of the gamma subunits (SCNN1G) to modulate ion transport processes. Structurally, Prostasin/PRSS8 forms a heterodimer comprising light and heavy chains, united by a disulfide bond, underscoring its functional complexity in mediating cellular responses.

Biological Activity

Measured by its ability to cleave the fluorogenic peptide substrate Boc-QAR-AMC. The specific activity is 31.804 pmoL/min/µg, as measured under the described conditions.

Species

Rat

Source

HEK293

Tag

C-His

Accession

Q9ES87 (A30-R322)

Gene ID
Molecular Construction
N-term
Prostasin (A30-R322)
Accession # Q9ES87
His
C-term
Protein Length

Partial

Synonyms
Channel-activating protease 1; CAP1; Serine protease 8
AA Sequence

ADGTEASCGAVIQPRITGGGSAKPGQWPWQVSITYNGVHVCGGSLVSNQWVVSAAHCFPREHSKEEYEVKLGAHQLDSFSNDIVVHTVAQIISHSSYREEGSQGDIALIRLSSPVTFSRYIRPICLPAANASFPNGLHCTVTGWGHVAPSVSLQTPRPLQQLEVPLISRETCSCLYNINAVPEEPHTIQQDMLCAGYVKGGKDACQGDSGGPLSCPIDGLWYLAGIVSWGDACGAPNRPGVYTLTSTYASWIHHHVAELQPRVVPQTQESQPDGHLCNHHPVFNLAAAQKLSR

분자량

Approximately 32.9 kDa.

Glycosylation
Yes
Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

각종 서류

Prostasin/PRSS8 Protein, Rat (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

Prostasin/PRSS8 Protein, Rat (HEK293, His)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
Prostasin/PRSS8 Protein, Rat (HEK293, His)
Cat. No.:
HY-P77155
수량:
MCE Japan Authorized Agent: