Prostasin/PRSS8 Protein, Rat (HEK293, His)

Prostasin/PRSS8 Protein, featuring trypsin-like cleavage specificity, crucially activates the epithelial sodium channel (ENaC) by cleaving gamma subunits (SCNN1G) and modulating ion transport. Structurally, it forms a disulfide bond-linked heterodimer with light and heavy chains, highlighting its intricate role in cellular responses. Prostasin/PRSS8 Protein, Rat (HEK293, His) is the recombinant rat-derived Prostasin/PRSS8 protein, expressed by HEK293 , with C-His labeled tag.

Prostasin/PRSS8, characterized by a trypsin-like cleavage specificity with a preference for poly-basic substrates, plays a crucial role in stimulating the activity of the epithelial sodium channel (ENaC). Its activation involves the cleavage of the gamma subunits (SCNN1G) to modulate ion transport processes. Structurally, Prostasin/PRSS8 forms a heterodimer comprising light and heavy chains, united by a disulfide bond, underscoring its functional complexity in mediating cellular responses.

Measured by its ability to cleave the fluorogenic peptide substrate Boc-QAR-AMC. The specific activity is 31.804 pmoL/min/µg, as measured under the described conditions.

Rat

HEK293

C-His

Q9ES87 (A30-R322)

192107  [NCBI]

Partial

ADGTEASCGAVIQPRITGGGSAKPGQWPWQVSITYNGVHVCGGSLVSNQWVVSAAHCFPREHSKEEYEVKLGAHQLDSFSNDIVVHTVAQIISHSSYREEGSQGDIALIRLSSPVTFSRYIRPICLPAANASFPNGLHCTVTGWGHVAPSVSLQTPRPLQQLEVPLISRETCSCLYNINAVPEEPHTIQQDMLCAGYVKGGKDACQGDSGGPLSCPIDGLWYLAGIVSWGDACGAPNRPGVYTLTSTYASWIHHHVAELQPRVVPQTQESQPDGHLCNHHPVFNLAAAQKLSR

Approximately 32.9 kDa.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.