Protein E7, HPV16 (His)
Based on 1 Customer Validation
HPV16 E7 is a viral phosphoprotein with oncogenic activity, belonging to the human papillomavirus early protein family. HPV16 E7 activates the cell cycle by releasing E2F through proteasome degradation of pRB. HPV16 E7 can cooperate with E6 to immortalize cells and neutralize the toxicity of E5, while activating the AP-1/NF-κB pathway and downregulating E-cadherin to enhance migration and invasion, making it a core target for cervical cancer. Protein E7, HPV (His) is a recombinant HPV E7 protein expressed from E. coli with an N-6*His tag.
- Species: Virus
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
HPV16 E7 is a viral phosphoprotein with oncogenic activity, belonging to the human papillomavirus early protein family. HPV16 E7 activates the cell cycle by releasing E2F through proteasome degradation of pRB. HPV16 E7 can cooperate with E6 to immortalize cells and neutralize the toxicity of E5, while activating the AP-1/NF-κB pathway and downregulating E-cadherin to enhance migration and invasion, making it a core target for cervical cancer. Protein E7, HPV (His) is a recombinant HPV E7 protein expressed from E. coli with an N-6*His tag.
Background
HPV16 E7 is a multifunctional nuclear phosphoprotein and a key oncoprotein in HPV16 carcinogenesis. It belongs to the human papillomavirus early protein family. The C-terminal half of HPV16 E7 contains two conserved Cys-X-X-Cys motifs, which can reversibly bind Zn2+ and Cd2+, significantly increase the α-helical content, and stabilize the hydrophobic core of the protein. The amino terminus of HPV16 E7 has sequence similarity with the adenovirus E1A protein and functional commonality with the SV40 large T antigen.
HPV16 E7 binds to the retinoblastoma protein (pRB) with high affinity, promotes its degradation through the proteasome pathway, and releases the transcription factor E2F to activate cell cycle progression. HPV16 E7 cooperates with the Ras oncogene to transform primary rodent cells. HPV16 E7 synergizes with E6 to immortalize primary human keratinocytes and neutralizes the cytotoxic effects of E5.
HPV16 E7 downregulates E-cadherin expression and enhances cell migration and invasion by activating AP-1 and NF-κB pathways. HPV16 E7 also disrupts cell adhesion and promotes epithelial-mesenchymal transition by interfering with cell-cell junctions and cytoskeletal rearrangement. Upstream regulatory factors of HPV16 E7 include viral promoters (such as LCR); downstream targets include pRB, E2F, p16 and E-cadherin, which can affect cell cycle control and adhesion molecule expression.
HPV16 E7 can be used to study the mechanism of action of cervical cancer development. The full-length E7 protein or E7 display vector (such as Lactobacillus casei) induces specific anti-tumor immunity in animal models such as TC-1 mice, inhibits tumor growth and improves survival rate. HPV16 E7 is the main target of HPV-related cancer therapeutic vaccines.
Verified Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized Protein E7 at 10 μg/mL (100 μL/well) can bind Biotinylated MYC. The ED50 for this effect is ≤0.3071 μg/mL.
Technical Parameters
-
Species Virus
-
Source E. coli
-
Tag N-6*His
-
Accession
P03129 (M1-P98)
-
Gene ID1489079 [NCBI]
-
Molecular Construction
-
N-term
-
6*His
-
Protein E7 (M1-P98)
Accession # P03129 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
Protein E7; E7
-
AA Sequence
MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP
-
Molecular Weight
Approximately 18-21 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 200 mM NaCl, pH 8.0.
3.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4, 8% trehalose.
4.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 6% trehalose.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (264 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
[1]. Pahel G, et al. Structural and functional characterization of the HPV16 E7 protein expressed in bacteria. J Biol Chem. 1993 Dec 5;268(34):26018-25. [Content Brief]
[2]. Boulenouar S, et al. Effects of HPV-16 E5, E6 and E7 proteins on survival, adhesion, migration and invasion of trophoblastic cells. Carcinogenesis. 2010 Mar;31(3):473-80. [Content Brief]
[3]. Li YL, et al. Vaccination of full-length HPV16 E6 or E7 protein inhibits the growth of HPV16 associated tumors. Oncol Rep. 2010 Nov;24(5):1323-9. [Content Brief]
[4]. Poo H, et al. Oral administration of human papillomavirus type 16 E7 displayed on Lactobacillus casei induces E7-specific antitumor effects in C57/BL6 mice. Int J Cancer. 2006 Oct 1;119(7):1702-9. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)