Protein E7, HPV16 (His)

Avis client

Based on 1 Customer Validation

HPV16 E7 is a viral phosphoprotein with oncogenic activity, belonging to the human papillomavirus early protein family. HPV16 E7 activates the cell cycle by releasing E2F through proteasome degradation of pRB. HPV16 E7 can cooperate with E6 to immortalize cells and neutralize the toxicity of E5, while activating the AP-1/NF-κB pathway and downregulating E-cadherin to enhance migration and invasion, making it a core target for cervical cancer. Protein E7, HPV (His) is a recombinant HPV E7 protein expressed from E. coli with an N-6*His tag.

Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.
  • Species: Virus
  • Source: E. coli
  • Stockage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Activité biologique
  • Technical Parameters
  • Product Properties
  • Documentation
  • Références
  • Help & FAQs

Activité biologique

Description

HPV16 E7 is a viral phosphoprotein with oncogenic activity, belonging to the human papillomavirus early protein family. HPV16 E7 activates the cell cycle by releasing E2F through proteasome degradation of pRB. HPV16 E7 can cooperate with E6 to immortalize cells and neutralize the toxicity of E5, while activating the AP-1/NF-κB pathway and downregulating E-cadherin to enhance migration and invasion, making it a core target for cervical cancer. Protein E7, HPV (His) is a recombinant HPV E7 protein expressed from E. coli with an N-6*His tag.

Background

HPV16 E7 is a multifunctional nuclear phosphoprotein and a key oncoprotein in HPV16 carcinogenesis. It belongs to the human papillomavirus early protein family. The C-terminal half of HPV16 E7 contains two conserved Cys-X-X-Cys motifs, which can reversibly bind Zn2+ and Cd2+, significantly increase the α-helical content, and stabilize the hydrophobic core of the protein. The amino terminus of HPV16 E7 has sequence similarity with the adenovirus E1A protein and functional commonality with the SV40 large T antigen.
HPV16 E7 binds to the retinoblastoma protein (pRB) with high affinity, promotes its degradation through the proteasome pathway, and releases the transcription factor E2F to activate cell cycle progression. HPV16 E7 cooperates with the Ras oncogene to transform primary rodent cells. HPV16 E7 synergizes with E6 to immortalize primary human keratinocytes and neutralizes the cytotoxic effects of E5.
HPV16 E7 downregulates E-cadherin expression and enhances cell migration and invasion by activating AP-1 and NF-κB pathways. HPV16 E7 also disrupts cell adhesion and promotes epithelial-mesenchymal transition by interfering with cell-cell junctions and cytoskeletal rearrangement. Upstream regulatory factors of HPV16 E7 include viral promoters (such as LCR); downstream targets include pRB, E2F, p16 and E-cadherin, which can affect cell cycle control and adhesion molecule expression.
HPV16 E7 can be used to study the mechanism of action of cervical cancer development. The full-length E7 protein or E7 display vector (such as Lactobacillus casei) induces specific anti-tumor immunity in animal models such as TC-1 mice, inhibits tumor growth and improves survival rate. HPV16 E7 is the main target of HPV-related cancer therapeutic vaccines.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Protein E7 at 10 μg/mL (100 μL/well) can bind Biotinylated MYC. The ED50 for this effect is ≤0.3071 μg/mL.

Données de validation de MCE

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA. Immobilized Protein E7 at 10 μg/mL (100 μL/well) can bind Biotinylated MYC. The ED50 for this effect is 0.2398 μg/mL, corresponding to a specific activity is 4.17×103 Unit/mg.

Technical Parameters

  • Species Virus
  • Source E. coli
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His
    • Protein E7 (M1-P98)
      Accession # P03129
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    Protein E7; E7

  • AA Sequence

    MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP

  • Masse moléculaire

    Approximately 18-21 kDa, based on SDS-PAGE under reducing conditions.

  • Pureté

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 200 mM NaCl, pH 8.0.
3.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4, 8% trehalose.
4.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 6% trehalose.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Livraison

Room temperature in continental US; may vary elsewhere.

Références

Calculators

Calculateur de reconstitution

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Calculateur de dilution

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Obtenir un devis En stock

Other size
Obtenir un devis
Please select quantity
Amount: USD 0.00