PTP-MEG2/PTPN9 Protein, Human (sf9, His-GST)
The PTP-MEG2/PTPN9 protein is a multifunctional protein tyrosine phosphatase with potential roles related to hydrophobic ligand transfer or Golgi function. It operates in a complex cellular environment, demonstrating the versatility of different molecular processes. PTP-MEG2/PTPN9 Protein, Human (sf9, His-GST) is the recombinant human-derived PTP-MEG2/PTPN9 protein, expressed by Sf9 insect cells , with C-His, N-GST labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The PTP-MEG2/PTPN9 protein is a multifunctional protein tyrosine phosphatase with potential roles related to hydrophobic ligand transfer or Golgi function. It operates in a complex cellular environment, demonstrating the versatility of different molecular processes. PTP-MEG2/PTPN9 Protein, Human (sf9, His-GST) is the recombinant human-derived PTP-MEG2/PTPN9 protein, expressed by Sf9 insect cells , with C-His, N-GST labeled tag.
Background
PTP-MEG2/PTPN9 protein, a protein-tyrosine phosphatase, is implicated in potential roles related to the transfer of hydrophobic ligands or functions associated with the Golgi apparatus. Operating within the intricate cellular landscape, PTP-MEG2/PTPN9 showcases versatility in its potential involvement in diverse molecular processes. Whether facilitating the transfer of hydrophobic ligands or contributing to Golgi-related functions, this phosphatase emerges as a multifunctional player, reflecting its significance in the intricate orchestration of cellular activities. The precise nature and extent of its contributions to these processes remain subjects of ongoing exploration, underscoring the need for further investigation into the multifaceted roles of PTP-MEG2/PTPN9 in cellular physiology.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag C-His;N-GST
-
Accession
P43378 (A285-Q593)
-
Molecular Construction
-
N-term
-
His-GST
-
PTPN9 (A285-Q593)
Accession # P43378 -
C-term
-
-
Protein Length
Partial
-
Synonyms
PTPN9; Protein-Tyrosine Phosphatase MEG2; Protein Tyrosine Phosphatase Non-Receptor Type 9; PTPase-MEG2; Tyrosine-Protein Phosphatase Non-Receptor Type 9; PTPase MEG2; MEG2; PTPMEG2
-
AA Sequence
AMTIQELVDYVNARQKQGIYEEYEDIRRENPVGTFHCSMSPGNLEKNRYGDVPCLDQTRVKLTKRSGHTQTDYINASFMDGYKQKNAYIGTQGPLENTYRDFWLMVWEQKVLVIVMTTRFEEGGRRKCGQYWPLEKDSRIRFGFLTVTNLGVENMNHYKKTTLEIHNTEERQKRQVTHFQFLSWPDYGVPSSAASLIDFLRVVRNQQSLAVSNMGARSKGQCPEPPIVVHCSAGIGRTGTFCSLDICLAQLEELGTLNVFQTVSRMRTQRAFSIQTPEQYYFCYKAILEFAEKEGMVSSGQNLLAVESQ
-
Predicted Molecular Mass
63.3 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
