1. Recombinant Proteins
  2. Others
  3. PTP-MEG2/PTPN9 Protein, Human (sf9, His-GST)

The PTP-MEG2/PTPN9 protein is a multifunctional protein tyrosine phosphatase with potential roles related to hydrophobic ligand transfer or Golgi function. It operates in a complex cellular environment, demonstrating the versatility of different molecular processes. PTP-MEG2/PTPN9 Protein, Human (sf9, His-GST) is the recombinant human-derived PTP-MEG2/PTPN9 protein, expressed by Sf9 insect cells , with C-His, N-GST labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The PTP-MEG2/PTPN9 protein is a multifunctional protein tyrosine phosphatase with potential roles related to hydrophobic ligand transfer or Golgi function. It operates in a complex cellular environment, demonstrating the versatility of different molecular processes. PTP-MEG2/PTPN9 Protein, Human (sf9, His-GST) is the recombinant human-derived PTP-MEG2/PTPN9 protein, expressed by Sf9 insect cells , with C-His, N-GST labeled tag.

Background

PTP-MEG2/PTPN9 protein, a protein-tyrosine phosphatase, is implicated in potential roles related to the transfer of hydrophobic ligands or functions associated with the Golgi apparatus. Operating within the intricate cellular landscape, PTP-MEG2/PTPN9 showcases versatility in its potential involvement in diverse molecular processes. Whether facilitating the transfer of hydrophobic ligands or contributing to Golgi-related functions, this phosphatase emerges as a multifunctional player, reflecting its significance in the intricate orchestration of cellular activities. The precise nature and extent of its contributions to these processes remain subjects of ongoing exploration, underscoring the need for further investigation into the multifaceted roles of PTP-MEG2/PTPN9 in cellular physiology.

Species

Human

Source

Sf9 insect cells

Tag

C-His;N-GST

Accession

P43378 (A285-Q593)

Gene ID
Molecular Construction
N-term
His-GST
PTPN9 (A285-Q593)
Accession # P43378
C-term
Protein Length

Partial

Synonyms
Tyrosine-protein phosphatase non-receptor type 9; PTPase MEG2; PTPN9
AA Sequence

AMTIQELVDYVNARQKQGIYEEYEDIRRENPVGTFHCSMSPGNLEKNRYGDVPCLDQTRVKLTKRSGHTQTDYINASFMDGYKQKNAYIGTQGPLENTYRDFWLMVWEQKVLVIVMTTRFEEGGRRKCGQYWPLEKDSRIRFGFLTVTNLGVENMNHYKKTTLEIHNTEERQKRQVTHFQFLSWPDYGVPSSAASLIDFLRVVRNQQSLAVSNMGARSKGQCPEPPIVVHCSAGIGRTGTFCSLDICLAQLEELGTLNVFQTVSRMRTQRAFSIQTPEQYYFCYKAILEFAEKEGMVSSGQNLLAVESQ

Predicted Molecular Mass
63.3 kDa
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

PTP-MEG2/PTPN9 Protein, Human (sf9, His-GST) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

PTP-MEG2/PTPN9 Protein, Human (sf9, His-GST)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PTP-MEG2/PTPN9 Protein, Human (sf9, His-GST)
Cat. No.:
HY-P77170
Quantity:
MCE Japan Authorized Agent: