1. Recombinant Proteins
  2. Immune Checkpoint Proteins CD Antigens Receptor Proteins
  3. Inhibitory Checkpoint Molecules Stimulatory Immune Checkpoint Molecules NK Cell CD Proteins Macrophage CD Proteins Monocyte CD Proteins Cell Adhesion Molecules (CAMs)
  4. Immunoglobulin-like Cell Adhesion Molecules
  5. PVR/CD155
  6. PVR/CD155 Protein, Mouse (HEK293, mFc)

The PVR/CD155 protein plays a key role in initiating natural killer (NK) cell effector functions by binding to CD96 and CD226 receptors. These interactions form mature immune synapses that trigger adhesion, lytic granule secretion, interferon-γ (IFN-γ), and cytotoxicity of activated NK cells. PVR/CD155 Protein, Mouse (HEK293, mFc) is the recombinant mouse-derived PVR/CD155 protein, expressed by HEK293, with C-mFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
50 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
100 μg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The PVR/CD155 protein plays a key role in initiating natural killer (NK) cell effector functions by binding to CD96 and CD226 receptors. These interactions form mature immune synapses that trigger adhesion, lytic granule secretion, interferon-γ (IFN-γ), and cytotoxicity of activated NK cells. PVR/CD155 Protein, Mouse (HEK293, mFc) is the recombinant mouse-derived PVR/CD155 protein, expressed by HEK293, with C-mFc labeled tag.

Background

PVR/CD155 Protein assumes a pivotal role in orchestrating natural killer (NK) cell adhesion and initiating NK cell effector functions by binding to two distinct NK cell receptors, CD96 and CD226. These receptor interactions converge at the cell-cell contact site, culminating in the formation of a mature immunological synapse between the NK cell and the target cell. This event triggers adhesion, secretion of lytic granules, interferon-gamma (IFN-gamma), and activation of cytotoxicity in activated NK cells. PVR/CD155 may additionally facilitate NK cell-target cell modular exchange and PVR transfer to the NK cell, particularly crucial in tumor cells expressing high levels of PVR. In such instances, the transfer mechanism may induce fratricide NK cell activation, providing a mechanism for tumors to evade the immune response. Furthermore, PVR/CD155 is implicated in mediating tumor cell invasion and migration. In the context of microbial infection, the protein acts as a receptor for poliovirus and potentially plays a role in the axonal transport of the virus. This function involves targeting virion-PVR-containing endocytic vesicles to the microtubular network through interaction with DYNLT1, thereby facilitating axonal retrograde transport of the virus.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized Mouse TIGIT, His Tag at 10 μg/mL (100 μL/well) can bind Mouse CD155, Mouse IgG2a Fc Tag with the EC50 of 0.18 μg/mL.

Species

Mouse

Source

HEK293

Tag

C-mFc

Accession

Q8K094 (D29-L348)

Gene ID

52118

Molecular Construction
N-term
PVR (D29-L348)
Accession # Q8K094
mFc
C-term
Protein Length

Partial

Synonyms
rMuCD155, His; Poliovirus receptor; CD155 antigen; Nectin-like protein 5; Nectin-2; Tage4 receptor; PVR; CD155
AA Sequence

DIRVLVPYNSTGVLGGSTTLHCSLTSNENVTITQITWMKKDSGGSHALVAVFHPKKGPNIKEPERVKFLAAQQDLRNASLAISNLSVEDEGIYECQIATFPRGSRSTNAWLKVQARPKNTAEALEPSPTLILQDVAKCISANGHPPGRISWPSNVNGSHREMKEPGSQPGTTTVTSYLSMVPSRQADGKNITCTVEHESLQELDQLLVTLSQPYPPENVSISGYDGNWYVGLTNLTLTCEAHSKPAPDMAGYNWSTNTGDFPNSVKRQGNMLLISTVEDGLNNTVIVCEVTNALGSGQGQVHIIVKEKPENMQQNTRLHL

Predicted Molecular Mass
61.8 kDa
Molecular Weight

Approximately 80-120 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Structure/Form
Monomer
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris, 100 mM glycine, 25 mM Arginine, 150 mM NaCl, pH 7.5, 10% trehalose.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

PVR/CD155 Protein, Mouse (HEK293, mFc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PVR/CD155 Protein, Mouse (HEK293, mFc)
Cat. No.:
HY-P704254
Quantity:
MCE Japan Authorized Agent: