1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. RAB27B Protein, Human (HEK293, Fc)

RAB27B is a dynamic small GTPase that regulates the late endocytic pathway by cycling between its active GTP-bound and inactive GDP-bound states. In the active state, RAB27B interacts with multiple effectors to coordinate endosomal localization, maturation, and secretion. RAB27B Protein, Human (HEK293, Fc) is the recombinant human-derived RAB27B protein, expressed by HEK293 , with N-mFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

RAB27B is a dynamic small GTPase that regulates the late endocytic pathway by cycling between its active GTP-bound and inactive GDP-bound states. In the active state, RAB27B interacts with multiple effectors to coordinate endosomal localization, maturation, and secretion. RAB27B Protein, Human (HEK293, Fc) is the recombinant human-derived RAB27B protein, expressed by HEK293 , with N-mFc labeled tag.

Background

RAB27B, a small GTPase, undergoes dynamic cycling between its active GTP-bound and inactive GDP-bound states, exerting regulatory control over the late endocytic pathway's homeostasis. In its active state, RAB27B engages with a diverse set of effector proteins, contributing to the coordination of endosomal positioning, maturation, and secretion processes. Notably, it plays a crucial role in facilitating the axonal anterograde transport of NTRK2/TRKB by promoting the association of NTRK2/TRKB with KLC1. Additionally, RAB27B may participate in the targeting of uroplakins to urothelial apical membranes, suggesting its involvement in specialized membrane trafficking events.

Species

Human

Source

HEK293

Tag

N-mFc

Accession

O00194 (T2-K215)

Gene ID
Molecular Construction
N-term
mFc
RAB27B (T2-K215)
Accession # O00194
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Ras-related protein Rab-27B; C25KG; RAB27B
AA Sequence

TDGDYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYNAQGPNGSSGKAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLPDQREVNERQARELADKYGIPYFETSAATGQNVEKAVETLLDLIMKRMEQCVEKTQIPDTVNGGNSGNLDGEKPPEKK

Predicted Molecular Mass
50.8 kDa
Molecular Weight

Approximately 51 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

RAB27B Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

RAB27B Protein, Human (HEK293, Fc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
RAB27B Protein, Human (HEK293, Fc)
Cat. No.:
HY-P75996
Quantity:
MCE Japan Authorized Agent: