RAB27B Protein, Human (HEK293, Fc)
RAB27B is a dynamic small GTPase that regulates the late endocytic pathway by cycling between its active GTP-bound and inactive GDP-bound states. In the active state, RAB27B interacts with multiple effectors to coordinate endosomal localization, maturation, and secretion. RAB27B Protein, Human (HEK293, Fc) is the recombinant human-derived RAB27B protein, expressed by HEK293 , with N-mFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
RAB27B is a dynamic small GTPase that regulates the late endocytic pathway by cycling between its active GTP-bound and inactive GDP-bound states. In the active state, RAB27B interacts with multiple effectors to coordinate endosomal localization, maturation, and secretion. RAB27B Protein, Human (HEK293, Fc) is the recombinant human-derived RAB27B protein, expressed by HEK293 , with N-mFc labeled tag.
Background
RAB27B, a small GTPase, undergoes dynamic cycling between its active GTP-bound and inactive GDP-bound states, exerting regulatory control over the late endocytic pathway's homeostasis. In its active state, RAB27B engages with a diverse set of effector proteins, contributing to the coordination of endosomal positioning, maturation, and secretion processes. Notably, it plays a crucial role in facilitating the axonal anterograde transport of NTRK2/TRKB by promoting the association of NTRK2/TRKB with KLC1. Additionally, RAB27B may participate in the targeting of uroplakins to urothelial apical membranes, suggesting its involvement in specialized membrane trafficking events.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag N-mFc
-
Accession
O00194 (T2-K215)
-
Molecular Construction
-
N-term
-
mFc
-
RAB27B (T2-K215)
Accession # O00194 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
RAB27B; C25KG; RAB27B, Member RAS Oncogene Family; Small Monomeric GTPase; Ras-Related Protein Rab-27B
-
AA Sequence
TDGDYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYNAQGPNGSSGKAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLPDQREVNERQARELADKYGIPYFETSAATGQNVEKAVETLLDLIMKRMEQCVEKTQIPDTVNGGNSGNLDGEKPPEKK
-
Predicted Molecular Mass
50.8 kDa
-
Molecular Weight
Approximately 51 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)