RAB27B Protein, Human (HEK293, Fc)

RAB27B is a dynamic small GTPase that regulates the late endocytic pathway by cycling between its active GTP-bound and inactive GDP-bound states. In the active state, RAB27B interacts with multiple effectors to coordinate endosomal localization, maturation, and secretion. RAB27B Protein, Human (HEK293, Fc) is the recombinant human-derived RAB27B protein, expressed by HEK293 , with N-mFc labeled tag.

RAB27B, a small GTPase, undergoes dynamic cycling between its active GTP-bound and inactive GDP-bound states, exerting regulatory control over the late endocytic pathway's homeostasis. In its active state, RAB27B engages with a diverse set of effector proteins, contributing to the coordination of endosomal positioning, maturation, and secretion processes. Notably, it plays a crucial role in facilitating the axonal anterograde transport of NTRK2/TRKB by promoting the association of NTRK2/TRKB with KLC1. Additionally, RAB27B may participate in the targeting of uroplakins to urothelial apical membranes, suggesting its involvement in specialized membrane trafficking events.

Human

HEK293

N-mFc

O00194 (T2-K215)

5874  [NCBI]

Full Length of Mature Protein

TDGDYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYNAQGPNGSSGKAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLPDQREVNERQARELADKYGIPYFETSAATGQNVEKAVETLLDLIMKRMEQCVEKTQIPDTVNGGNSGNLDGEKPPEKK

Approximately 51 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

≥ 95%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.