RANKL/TNFSF11 Protein, Human (HEK293, His)
RANKL/TNFSF11 Protein, Human (HEK293, His) is the recombinant human-derived RANKL/TNFSF11 protein, expressed by HEK293, with N-His tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
RANKL/TNFSF11 Protein, Human (HEK293, His) is the recombinant human-derived RANKL/TNFSF11 protein, expressed by HEK293, with N-His tag.
Background
RANKL/TNFSF11 is a cytokine that binds to TNFRSF11B/OPG and TNFRSF11A/RANK. It acts as an osteoclast differentiation and activation factor, enhances the ability of dendritic cells to stimulate naive T-cell proliferation, and may be a key regulator of T-cell–dendritic cell interactions and T-cell-dependent immune responses. It also likely contributes to increased bone resorption in humoral hypercalcemia of malignancy. By activating multiple signaling pathways in osteoclast precursor cells—particularly through inducing prolonged intracellular Ca 2+ oscillations that activate NFATC1 (leading to its nuclear translocation and induction of osteoclast-specific gene transcription)—RANKL/TNFSF11 promotes osteoclastogenesis. During osteoclast differentiation, it also triggers TMEM64- and ATP2A2-dependent CREB1 activation and mitochondrial ROS generation, which are essential for proper osteoclast formation (By similarity).
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag N-His
-
Accession
AAC51762.1 (G64-D245)
-
Gene ID/
-
Molecular Construction
-
N-term
-
His
-
RANKL (G64-D245)
Accession # AAC51762.1 -
C-term
-
-
Protein Length
Partial Extracellular Domain
-
Synonyms
TNFSF11; Tumor Necrosis Factor (Ligand) Superfamily, Member 11; TNF Superfamily Member 11; Receptor Activator Of Nuclear Factor Kappa-B Ligand; TRANCE; TNLG6B; RANKL; Receptor Activator Of Nuclear Factor Kappa B Ligand; OPGL; Tumor Necrosis Factor Ligand
-
AA Sequence
GSQHIRAEKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWGKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDID
-
Predicted Molecular Mass
22.4 kDa
-
Molecular Weight
Approximately 28-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Structure/Form
Monomer
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
