RANKL/TNFSF11 Protein, Mouse (HEK293, His, Flag)
RANKL/TNFSF11 Protein, Mouse (HEK293, His, Flag) is the recombinant mouse-derived RANKL/TNFSF11, expressed by HEK293 , with C-Flag, C-6*His labeled tag. ,
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
RANKL/TNFSF11 Protein, Mouse (HEK293, His, Flag) is the recombinant mouse-derived RANKL/TNFSF11, expressed by HEK293 , with C-Flag, C-6*His labeled tag. ,
Background
RANKL/TNFSF11 is a cytokine that binds to TNFRSF11B/OPG and TNFRSF11A/RANK, functioning as an osteoclast differentiation and activation factor. It enhances the ability of dendritic cells to stimulate naive T-cell proliferation and may serve as a key regulator of T-cell and dendritic cell interactions, potentially influencing T-cell-dependent immune responses. Additionally, RANKL/TNFSF11 induces osteoclastogenesis by activating multiple signaling pathways in osteoclast precursor cells, notably triggering sustained oscillations in intracellular Ca2+ concentration, leading to NFATC1 activation and osteoclast-specific gene transcription. During osteoclast differentiation, it activates CREB1 and generates mitochondrial ROS in a TMEM64- and ATP2A2-dependent manner, essential for proper osteoclast formation. By similarity, it may also play a role in increased bone resorption in humoral hypercalcemia of malignancy.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-Flag;C-6*His
-
Accession
O35235-1 (K158-D316)
-
Gene ID21943
-
Protein Length
Partial
-
Synonyms
TNFSF11; Tumor Necrosis Factor (Ligand) Superfamily, Member 11; TNF Superfamily Member 11; Receptor Activator Of Nuclear Factor Kappa-B Ligand; TRANCE; TNLG6B; RANKL; Receptor Activator Of Nuclear Factor Kappa B Ligand; OPGL; Tumor Necrosis Factor Ligand
-
AA Sequence
KPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID
-
Predicted Molecular Mass
23 kDa
-
Molecular Weight
Approximately 23-29 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
