RCVRN Protein, Human (sf9, His-Myc)

The RCVRN protein is a calcium sensor that regulates phototransduction in cone and rod photoreceptors, enhancing the light sensitivity of cone photoreceptors in dark conditions. Under low light, it prolongs RHO/rhodopsin activation in rod photoreceptor cells by inhibiting GRK1-mediated phosphorylation. RCVRN Protein, Human (sf9, His-Myc) is the recombinant human-derived RCVRN protein, expressed by sf9 insect cells , with N-10*His, C-Myc labeled tag.

RCVRN protein serves as a calcium sensor, intricately involved in regulating phototransduction in both cone and rod photoreceptor cells. It plays a crucial role in modulating the light sensitivity of cone photoreceptors, particularly in dark and dim conditions. In response to elevated Ca(2+) levels induced by low light, RCVRN extends the activation of RHO/rhodopsin in rod photoreceptor cells by binding to and inhibiting GRK1-mediated phosphorylation of RHO/rhodopsin. This protein contributes to scotopic vision, enhancing vision in low-light conditions by facilitating signal transfer between rod photoreceptors and rod bipolar cells. Moreover, RCVRN improves rod photoreceptor sensitivity in dim light, mediating responses that aid in the detection of changes and motion in bright light. Existing as a homodimer, RCVRN undergoes disulfide-linked dimerization, a process triggered by prolonged intense illumination. Additionally, RCVRN may form a complex with RHO and GRK1 in a Ca(2+)-dependent manner, preventing the interaction between GRK1 and RHO.

Human

Sf9 insect cells

N-10*His;C-Myc

P35243 (G2-A200)

5957  [NCBI]

Full Length of Mature Protein

GNSKSGALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQSIYAKFFPDTDPKAYAQHVFRSFDSNLDGTLDFKEYVIALHMTTAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVMAIFKMITPEDVKLLPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKMKNA

≥ 90%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.