RCVRN Protein, Human (sf9, His-Myc)

The RCVRN protein is a calcium sensor that regulates phototransduction in cone and rod photoreceptors, enhancing the light sensitivity of cone photoreceptors in dark conditions. Under low light, it prolongs RHO/rhodopsin activation in rod photoreceptor cells by inhibiting GRK1-mediated phosphorylation. RCVRN Protein, Human (sf9, His-Myc) is the recombinant human-derived RCVRN protein, expressed by sf9 insect cells , with N-10*His, C-Myc labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: Sf9 insect cells
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The RCVRN protein is a calcium sensor that regulates phototransduction in cone and rod photoreceptors, enhancing the light sensitivity of cone photoreceptors in dark conditions. Under low light, it prolongs RHO/rhodopsin activation in rod photoreceptor cells by inhibiting GRK1-mediated phosphorylation. RCVRN Protein, Human (sf9, His-Myc) is the recombinant human-derived RCVRN protein, expressed by sf9 insect cells , with N-10*His, C-Myc labeled tag.

Background

RCVRN protein serves as a calcium sensor, intricately involved in regulating phototransduction in both cone and rod photoreceptor cells. It plays a crucial role in modulating the light sensitivity of cone photoreceptors, particularly in dark and dim conditions. In response to elevated Ca(2+) levels induced by low light, RCVRN extends the activation of RHO/rhodopsin in rod photoreceptor cells by binding to and inhibiting GRK1-mediated phosphorylation of RHO/rhodopsin. This protein contributes to scotopic vision, enhancing vision in low-light conditions by facilitating signal transfer between rod photoreceptors and rod bipolar cells. Moreover, RCVRN improves rod photoreceptor sensitivity in dim light, mediating responses that aid in the detection of changes and motion in bright light. Existing as a homodimer, RCVRN undergoes disulfide-linked dimerization, a process triggered by prolonged intense illumination. Additionally, RCVRN may form a complex with RHO and GRK1 in a Ca(2+)-dependent manner, preventing the interaction between GRK1 and RHO.

Technical Parameters

  • Species Human
  • Source Sf9 insect cells
  • Tag N-10*His;C-Myc
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 10*His
    • RCVRN (G2-A200)
      Accession # P35243
    • Myc
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    RCVRN; Cancer-Associated Retinopathy Protein; Prev. RCV1; Protein CAR; Recoverin; Cancer Associated Retinopathy Antigen

  • AA Sequence

    GNSKSGALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQSIYAKFFPDTDPKAYAQHVFRSFDSNLDGTLDFKEYVIALHMTTAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVMAIFKMITPEDVKLLPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKMKNA

  • Predicted Molecular Mass

    27 kDa

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00