RIPK1 Protein, Canine (Active, sf9, GST)
RIPK1 Protein, Canine (Active, sf9, GST) is the recombinant dog-derived RIPK1, expressed by Sf9 insect cells , with GST labeled tag.
- Species: Dog
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
RIPK1 Protein, Canine (Active, sf9, GST) is the recombinant dog-derived RIPK1, expressed by Sf9 insect cells , with GST labeled tag.
Background
RIPK1, a serine-threonine kinase, stands as a pivotal regulator orchestrating TNF-mediated apoptosis, necroptosis, and inflammatory pathways. Functionally, RIPK1 exhibits kinase-dependent roles in cell death regulation and kinase-independent scaffold functions governing inflammatory signaling and cell survival. As a scaffold protein within the TNF-R1 signaling complex, RIPK1 promotes cell survival by activating the canonical NF-kappa-B pathway. In the context of cell death, RIPK1, through its kinase activity, crucially regulates the assembly of death-inducing complexes—complex IIa (RIPK1-FADD-CASP8) for apoptosis and complex IIb (RIPK1-RIPK3-MLKL) for necroptosis. In normal conditions, RIPK1 inhibits RIPK3-dependent necroptosis by impeding the interaction of TRADD with FADD, thus limiting aberrant CASP8 activation. Additionally, RIPK1 contributes to the inflammatory response by fostering the transcriptional production of pro-inflammatory cytokines like interleukin-6 (IL6). Notably, RIPK1's kinase activity extends to phosphorylating RIPK3, DAB2IP, and participating in ZBP1-induced NF-kappa-B activation in response to DNA damage, highlighting its multifaceted roles in cellular processes.
Technical Parameters
-
Species Dog
-
Source Sf9 insect cells
-
Tag GST
-
Accession
A0A8I3S2L7 (M1-P327)
-
Gene ID/
-
Protein Length
Partial
-
Synonyms
RIPK1; Receptor-Interacting Protein Kinase 1; Receptor Interacting Serine/Threonine Kinase 1; Receptor-Interacting Protein 1; RIP-1; Cell Death Protein RIP; RIP1; Serine/Threonine-Protein Kinase RIP; RIP; AIEFL; Receptor (TNFRSF)-Interacting Serine-Threon
-
AA Sequence
MSLDDIKMKSSDFLEKEHLDSGGFGKVSLCLHRSHGLVILKKVYTGPKRTEYNESLLEEGRMMHRLRHRRVVKLLGVILEEGNYSLVMEYMEKGNLMHVLKAEVSIPLSVKGRIIMETIEGMCYLHGEGVIHKDLKPENILVDDDFHIKIADLGVASFKTWSKLTKEEINEQRKLNSVSKKNGGTLCYMAPEHLNDINAKPSEKSDVYSFGIVLWAIFANKEPYENAICEQQLILCIKSGNRPDVEDIIEYCPEEIISIMKQCWEAKPEIRPTFAGIEEKFRPFYEDQLEENVEEDVTSLKKEYPDPAQNSVVKRMQSLQIDCVATP
-
Molecular Weight
Approximately 63 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)