1. Recombinant Proteins
  2. Enzymes & Regulators Kinases
  3. Transferases (EC 2) Serine/Threonine Kinase Proteins TKL
  4. RIPK
  5. RIPK1
  6. RIPK1 Protein, Canine (Active, sf9, GST)

RIPK1 Protein, Canine (Active, sf9, GST) is the recombinant dog-derived RIPK1, expressed by Sf9 insect cells , with GST labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 재고
50 μg   견적 받기  
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

RIPK1 Protein, Canine (Active, sf9, GST) is the recombinant dog-derived RIPK1, expressed by Sf9 insect cells , with GST labeled tag.

Background

RIPK1, a serine-threonine kinase, stands as a pivotal regulator orchestrating TNF-mediated apoptosis, necroptosis, and inflammatory pathways. Functionally, RIPK1 exhibits kinase-dependent roles in cell death regulation and kinase-independent scaffold functions governing inflammatory signaling and cell survival. As a scaffold protein within the TNF-R1 signaling complex, RIPK1 promotes cell survival by activating the canonical NF-kappa-B pathway. In the context of cell death, RIPK1, through its kinase activity, crucially regulates the assembly of death-inducing complexes—complex IIa (RIPK1-FADD-CASP8) for apoptosis and complex IIb (RIPK1-RIPK3-MLKL) for necroptosis. In normal conditions, RIPK1 inhibits RIPK3-dependent necroptosis by impeding the interaction of TRADD with FADD, thus limiting aberrant CASP8 activation. Additionally, RIPK1 contributes to the inflammatory response by fostering the transcriptional production of pro-inflammatory cytokines like interleukin-6 (IL6). Notably, RIPK1's kinase activity extends to phosphorylating RIPK3, DAB2IP, and participating in ZBP1-induced NF-kappa-B activation in response to DNA damage, highlighting its multifaceted roles in cellular processes.

Species

Dog

Source

Sf9 insect cells

Tag

GST

Accession

A0A8I3S2L7 (M1-P327)

Gene ID

/

Protein Length

Partial

Synonyms
Receptor interacting serine/threonine kinase 1; RIPK1
AA Sequence

MSLDDIKMKSSDFLEKEHLDSGGFGKVSLCLHRSHGLVILKKVYTGPKRTEYNESLLEEGRMMHRLRHRRVVKLLGVILEEGNYSLVMEYMEKGNLMHVLKAEVSIPLSVKGRIIMETIEGMCYLHGEGVIHKDLKPENILVDDDFHIKIADLGVASFKTWSKLTKEEINEQRKLNSVSKKNGGTLCYMAPEHLNDINAKPSEKSDVYSFGIVLWAIFANKEPYENAICEQQLILCIKSGNRPDVEDIIEYCPEEIISIMKQCWEAKPEIRPTFAGIEEKFRPFYEDQLEENVEEDVTSLKKEYPDPAQNSVVKRMQSLQIDCVATP

Predicted Molecular Mass
63 kDa
Purity

≥ 90%, as determined by reducing SDS-PAGE.

각종 서류

RIPK1 Protein, Canine (Active, sf9, GST) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

RIPK1 Protein, Canine (Active, sf9, GST)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
RIPK1 Protein, Canine (Active, sf9, GST)
Cat. No.:
HY-P703063
수량:
MCE Japan Authorized Agent: