1. Recombinant Proteins
  2. Enzymes & Regulators Kinases
  3. Transferases (EC 2) Serine/Threonine Kinase Proteins TKL
  4. RIPK
  5. RIPK1
  6. RIPK1 Protein, Canine (Active, sf9, GST)

RIPK1 Protein, Canine (Active, sf9, GST) is the recombinant dog-derived RIPK1, expressed by Sf9 insect cells , with GST labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

RIPK1 Protein, Canine (Active, sf9, GST) is the recombinant dog-derived RIPK1, expressed by Sf9 insect cells , with GST labeled tag.

Background

RIPK1, a serine-threonine kinase, stands as a pivotal regulator orchestrating TNF-mediated apoptosis, necroptosis, and inflammatory pathways. Functionally, RIPK1 exhibits kinase-dependent roles in cell death regulation and kinase-independent scaffold functions governing inflammatory signaling and cell survival. As a scaffold protein within the TNF-R1 signaling complex, RIPK1 promotes cell survival by activating the canonical NF-kappa-B pathway. In the context of cell death, RIPK1, through its kinase activity, crucially regulates the assembly of death-inducing complexes—complex IIa (RIPK1-FADD-CASP8) for apoptosis and complex IIb (RIPK1-RIPK3-MLKL) for necroptosis. In normal conditions, RIPK1 inhibits RIPK3-dependent necroptosis by impeding the interaction of TRADD with FADD, thus limiting aberrant CASP8 activation. Additionally, RIPK1 contributes to the inflammatory response by fostering the transcriptional production of pro-inflammatory cytokines like interleukin-6 (IL6). Notably, RIPK1's kinase activity extends to phosphorylating RIPK3, DAB2IP, and participating in ZBP1-induced NF-kappa-B activation in response to DNA damage, highlighting its multifaceted roles in cellular processes.

Species

Dog

Source

Sf9 insect cells

Tag

GST

Accession

A0A8I3S2L7 (M1-P327)

Gene ID

/

Protein Length

Partial

Synonyms
Receptor interacting serine/threonine kinase 1; RIPK1
AA Sequence

MSLDDIKMKSSDFLEKEHLDSGGFGKVSLCLHRSHGLVILKKVYTGPKRTEYNESLLEEGRMMHRLRHRRVVKLLGVILEEGNYSLVMEYMEKGNLMHVLKAEVSIPLSVKGRIIMETIEGMCYLHGEGVIHKDLKPENILVDDDFHIKIADLGVASFKTWSKLTKEEINEQRKLNSVSKKNGGTLCYMAPEHLNDINAKPSEKSDVYSFGIVLWAIFANKEPYENAICEQQLILCIKSGNRPDVEDIIEYCPEEIISIMKQCWEAKPEIRPTFAGIEEKFRPFYEDQLEENVEEDVTSLKKEYPDPAQNSVVKRMQSLQIDCVATP

Predicted Molecular Mass
63 kDa
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Documentation

RIPK1 Protein, Canine (Active, sf9, GST) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

RIPK1 Protein, Canine (Active, sf9, GST)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
RIPK1 Protein, Canine (Active, sf9, GST)
Cat. No.:
HY-P703063
Quantity:
MCE Japan Authorized Agent: