RIPK1 Protein, Canine (Active, sf9, GST)

RIPK1 Protein, Canine (Active, sf9, GST) is the recombinant dog-derived RIPK1, expressed by Sf9 insect cells , with GST labeled tag.

For research use only. We do not sell to patients.
  • Species: Dog
  • Source: Sf9 insect cells
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

RIPK1 Protein, Canine (Active, sf9, GST) is the recombinant dog-derived RIPK1, expressed by Sf9 insect cells , with GST labeled tag.

Background

RIPK1, a serine-threonine kinase, stands as a pivotal regulator orchestrating TNF-mediated apoptosis, necroptosis, and inflammatory pathways. Functionally, RIPK1 exhibits kinase-dependent roles in cell death regulation and kinase-independent scaffold functions governing inflammatory signaling and cell survival. As a scaffold protein within the TNF-R1 signaling complex, RIPK1 promotes cell survival by activating the canonical NF-kappa-B pathway. In the context of cell death, RIPK1, through its kinase activity, crucially regulates the assembly of death-inducing complexes—complex IIa (RIPK1-FADD-CASP8) for apoptosis and complex IIb (RIPK1-RIPK3-MLKL) for necroptosis. In normal conditions, RIPK1 inhibits RIPK3-dependent necroptosis by impeding the interaction of TRADD with FADD, thus limiting aberrant CASP8 activation. Additionally, RIPK1 contributes to the inflammatory response by fostering the transcriptional production of pro-inflammatory cytokines like interleukin-6 (IL6). Notably, RIPK1's kinase activity extends to phosphorylating RIPK3, DAB2IP, and participating in ZBP1-induced NF-kappa-B activation in response to DNA damage, highlighting its multifaceted roles in cellular processes.

Technical Parameters

  • Species Dog
  • Source Sf9 insect cells
  • Tag GST
  • Accession
  • Gene ID
  • Protein Length

    Partial

  • Synonyms

    RIPK1; Receptor-Interacting Protein Kinase 1; Receptor Interacting Serine/Threonine Kinase 1; Receptor-Interacting Protein 1; RIP-1; Cell Death Protein RIP; RIP1; Serine/Threonine-Protein Kinase RIP; RIP; AIEFL; Receptor (TNFRSF)-Interacting Serine-Threon

  • AA Sequence

    MSLDDIKMKSSDFLEKEHLDSGGFGKVSLCLHRSHGLVILKKVYTGPKRTEYNESLLEEGRMMHRLRHRRVVKLLGVILEEGNYSLVMEYMEKGNLMHVLKAEVSIPLSVKGRIIMETIEGMCYLHGEGVIHKDLKPENILVDDDFHIKIADLGVASFKTWSKLTKEEINEQRKLNSVSKKNGGTLCYMAPEHLNDINAKPSEKSDVYSFGIVLWAIFANKEPYENAICEQQLILCIKSGNRPDVEDIIEYCPEEIISIMKQCWEAKPEIRPTFAGIEEKFRPFYEDQLEENVEEDVTSLKKEYPDPAQNSVVKRMQSLQIDCVATP

  • Molecular Weight

    Approximately 63 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00