RIPK2 Protein, Human (Active, 299a.a, sf9, His-GST)

RIPK2 is a multifunctional serine/threonine/tyrosine protein kinase that coordinates innate and adaptive immune responses. It is activated by bacterial peptidoglycan to form filaments in the NOD1 and NOD2 pathways, undergoing autophosphorylation and polyubiquitination. RIPK2 Protein, Human (Active, 299a.a, sf9, His-GST) is the recombinant human-derived RIPK2 protein, expressed by Sf9 insect cells , with N-6*His, N-GST labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: Sf9 insect cells
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Help & FAQs

Biological Activity

Description

RIPK2 is a multifunctional serine/threonine/tyrosine protein kinase that coordinates innate and adaptive immune responses. It is activated by bacterial peptidoglycan to form filaments in the NOD1 and NOD2 pathways, undergoing autophosphorylation and polyubiquitination. RIPK2 Protein, Human (Active, 299a.a, sf9, His-GST) is the recombinant human-derived RIPK2 protein, expressed by Sf9 insect cells , with N-6*His, N-GST labeled tag.

Background

RIPK2, a serine/threonine/tyrosine-protein kinase, plays a pivotal role in orchestrating innate and adaptive immune responses. As a key effector in NOD1 and NOD2 signaling pathways, RIPK2 forms filaments upon activation by bacterial peptidoglycans, recruited via CARD-CARD domains. Autophosphorylation and polyubiquitination follow, involving 'Lys-63'-linked ubiquitin chains by XIAP, BIRC2, and BIRC3, as well as 'Met-1'-linked polyubiquitination by the LUBAC complex. This transforms RIPK2 into a scaffolding protein, recruiting downstream effectors. 'Lys-63'-linked polyubiquitin chains on RIPK2 facilitate the recruitment of IKBKG/NEMO, initiating the activation of IKBKB/IKKB and subsequent NF-kappa-B release from inhibitors. While the kinase activity is dispensable for NOD1 and NOD2 pathways, RIPK2 contributes to tyrosine phosphorylation of ARHGEF2, activating NF-kappa-B through NOD2. Additionally, in adaptive immunity, RIPK2 promotes BCL10 phosphorylation during T-cell receptor engagement, and participates in RHOA inactivation in response to NGFR signaling. This multifaceted kinase stands as a crucial mediator in diverse immune processes.

Technical Parameters

  • Species Human
  • Source Sf9 insect cells
  • Tag N-6*His;N-GST
  • Accession
  • Gene ID
  • Protein Length

    Partial

  • Synonyms

    RIPK2; Receptor-Interacting Protein (RIP)-Like Interacting Caspase-Like Apoptosis Regulatory Protein (CLARP) Kinase; Receptor Interacting Serine/Threonine Kinase 2; CARD-Containing Interleukin-1 Beta-Converting Enzyme (ICE)-Associated Kinase; CARDIAK; CARD-Containing Interleukin-1 Beta-Converting Enzyme-Associated Kinase; RIP2; Receptor-Interacting Serine-Threonine Kinase 2 Isoform B; RICK; Receptor-Interacting Serine-Threonine Kinase 2 Isoform 2; Receptor-Interacting Serine/Threonine-Protein Kinase 2; Receptor-Interacting Serine-Threonine Kinase 2; Receptor-Interacting Protein 2; RIP-Like-Interacting CLARP Kinase; Tyrosine-Protein Kinase RIPK2; Growth-Inhibiting Gene 30; CARD3; CARD-Carrying Kinase; CARD-Containing IL-1 Beta ICE-Kinase; GIG30; RIP-2; CCK

  • AA Sequence

    MNGEAICSALPTIPYHKLADLRYLSRGASGTVSSARHADWRVQVAVKHLHIHTPLLDSERKDVLREAEILHKARFSYILPILGICNEPEFLGIVTEYMPNGSLNELLHRKTEYPDVAWPLRFRILHEIALGVNYLHNMTPPLLHHDLKTQNILLDNEFHVKIADFGLSKWRMMSLSQSRSSKSAPEGGTIIYMPPENYEPGQKSRASIKHDIYSYAVITWEVLSRKQPFEDVTNPLQIMYSVSQGHRPVINEESLPYDIPHRARMISLIESGWAQNPDERPSFLKCLIELEPVLRTFEE

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00