Copy Link Print Information

RLN1/Relaxin-1 Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

The RLN1/Relaxin-1 protein is an important ovarian hormone that cooperates with estrogen to induce birth canal dilation. It plays a vital role in connective tissue remodeling during pregnancy, promoting pubic ligament growth and cervical ripening. RLN1/Relaxin-1 Protein, Human (HEK293, His) is the recombinant human-derived RLN1/Relaxin-1 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for RLN1/Relaxin-1 Protein, Human (HEK293, His)
  • Experimental Validation Results for RLN1/Relaxin-1 Protein, Human (HEK293, His)
  • RLN1/Relaxin-1 Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The RLN1/Relaxin-1 protein is an important ovarian hormone that cooperates with estrogen to induce birth canal dilation. It plays a vital role in connective tissue remodeling during pregnancy, promoting pubic ligament growth and cervical ripening. RLN1/Relaxin-1 Protein, Human (HEK293, His) is the recombinant human-derived RLN1/Relaxin-1 protein, expressed by HEK293 , with C-His labeled tag.

Background

RLN1, also known as Relaxin-1, is a vital ovarian hormone that collaborates with estrogen, particularly in numerous mammals, to induce the dilation of the birth canal. This hormone plays a crucial role in the remodeling of connective tissues during pregnancy, facilitating the growth of pubic ligaments and the ripening of the cervix. The functional form of RLN1 exists as a heterodimer, comprised of a B chain and an A chain, intricately linked by two disulfide bonds. Through its intricate molecular structure, RLN1 contributes significantly to the intricate processes associated with pregnancy, influencing the adaptive changes in the female reproductive system to support a successful birth.

Verified Bioactivity

Measured by its ability to induce cAMP accumulation in THP-1 human acute monocytic leukemia cells. The ED50 for this effect is 10.95 ng/mL, corresponding to a specific activity is 9.132×104 U/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 90%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to induce cAMP accumulation in THP-1 human acute monocytic leukemia cells. The ED50 for this effect is 10.95 ng/mL, corresponding to a specific activity is 9.132×104 U/mg.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession

    P04808 (V23-C185)

  • Gene ID
    6013  [NCBI]
  • Molecular Construction
    • N-term
    • RLN1 (V23-C185)
      Accession # P04808
    • His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    RLN1; Relaxin 1 (H1); Relaxin 1; BA12D24.3.1; Prorelaxin H1; BA12D24.3.2; H1; H1RLX; Preprorelaxin H1; RLXH1

  • AA Sequence

    VAAKWKDDVIKLCGRELVRAQIAICGMSTWSKRSLSQEDAPQTPRPVAEIVPSFINKDTETIIIMLEFIANLPPELKAALSERQPSLPELQQYVPALKDSNLSFEEFKKLIRNRQSEAADSNPSELKYLGLDTHSQKKRRPYVALFEKCCLIGCTKRSLAKYC

  • Molecular Weight

    Approximately 20 kDa

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 90%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its ability to induce cAMP accumulation in THP-1 human acute monocytic leukemia cells. The ED50 for this effect is 10.95 ng/mL, corresponding to a specific activity is 9.132×104 U/mg.

  • RLN1/Relaxin-1 Protein, Human (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for RLN1/Relaxin-1 Protein, Human (HEK293, His)
  • Experimental Validation Results for RLN1/Relaxin-1 Protein, Human (HEK293, His)
  • RLN1/Relaxin-1 Protein, Human (HEK293, His) Product Image