RNF135 Protein, Human
Based on 1 Customer Validation
The RNF135 protein acts as an E2-dependent E3 ubiquitin protein ligase and serves as a RIGI coreceptor for viral RNA sensing and activation of antiviral innate immune responses. RNF135 Protein, Human is the recombinant human-derived RNF135 protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
The RNF135 protein acts as an E2-dependent E3 ubiquitin protein ligase and serves as a RIGI coreceptor for viral RNA sensing and activation of antiviral innate immune responses. RNF135 Protein, Human is the recombinant human-derived RNF135 protein, expressed by E. coli , with tag free.
RNF135, as an E2-dependent E3 ubiquitin-protein ligase, plays a pivotal role in the innate immune response by serving as a coreceptor for RIGI in the detection of viral RNAs within the cell cytoplasm. Collaborating with the UBE2D3, UBE2N, and UB2V1 E2 ligases, RNF135 orchestrates the 'Lys-63'-linked polyubiquitination of RIGI, which is crucial for the activation of the RIG-I signaling pathway during viral infection. Additionally, through a ubiquitin-independent mechanism, RNF135 facilitates the bridging of RIGI filaments formed on longer viral RNAs, further enhancing RIG-I pathway activation. This dual mechanism, involving both ubiquitin-dependent and -independent processes, suggests a sophisticated regulation of the RIG-I signaling pathway, potentially influenced by the length of the viral RNA. Furthermore, in association with the E2 ligase UBE2N, RNF135 constitutively generates unanchored 'Lys-63'-linked polyubiquitin chains, providing an alternative means to activate the RIG-I signaling pathway and emphasizing the complexity of RNF135's involvement in antiviral immune responses.
The ubiquitin conjugating activity of RNF135 was validated through its ability to catalyse the generation of polyubiquitin chains in the presence of the E1 activating enzyme UBE1, the E2 conjugating enzyme Ubch5b and Bodipy-ubiquitin. Incubation of RNF135 for 60 minutes at 37°C in the presence of Bodipy-ubiquitin, UBE1, Ubch5b and ATP was compared alongside two control reactions with either RNF135 or RNF135&ATP excluded from the reaction. Ubiquitin conjugates were identified by the migration of the Bodipy-ubiquitin band and these were observed only in the presence of ATP and RNF135.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
Q8IUD6 (A2-V432)
-
Gene ID84282
-
Molecular Construction
-
N-term
-
RNF135 (A2-V432)
Accession # Q8IUD6 -
C-term
-
-
Protein Length
Partial
-
Synonyms
RNF135; RIG-I E3 Ubiquitin Ligase; Ring Finger Protein 135; MGC13061; Riplet; REUL; RING Finger Protein Leading To RIG-I Activation; RING Finger Protein 135; RING-Type E3 Ubiquitin Transferase RNF135; MMFD; E3 Ubiquitin-Protein Ligase RNF135; L13
-
AA Sequence
AGLGLGSAVPVWLAEDDLGCIICQGLLDWPATLPCGHSFCRHCLEALWGARDARRWACPTCRQGAAQQPHLRKNTLLQDLADKYRRAAREIQAGSDPAHCPCPGSSSLSSAAARPRRRPELQRVAVEKSITEVAQELTELVEHLVDIVRSLQNQRPLSESGPDNELSILGKAFSSGVDLSMASPKLVTSDTAAGKIRDILHDLEEIQEKLQESVTWKEAPEAQMQGELLEAPSSSSCPLPDQSHPALRRASRFAQWAIHPTFNLKSLSCSLEVSKDSRTVTVSHRPQPYRWSCERFSTSQVLCSQALSSGKHYWEVDTRNCSHWAVGVASWEMSRDQVLGRTMDSCCVEWKGTSQLSAWHMVKETVLGSDRPGVVGIWLNLEEGKLAFYSVDNQEKLLYECTISASSPLYPAFWLYGLHPGNYLIIKQVKV
-
Molecular Weight
Approximately 48 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
Supplied as a 0.22 μm filtered solution of 50 mM HEPES, pH 7.5, 200 mM NaCl, 20% glycerol, 1 mM DTT.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
