S100A1 Protein, Human (C-His)

Customer Review

Based on 1 Customer Validation

S100A1 is a small calcium-binding protein that plays critical roles in multiple processes, including Ca(2+) homeostasis and cardiomyocyte regulation. Elevated intracellular Ca(2+) triggers conformational changes in S100A1, thereby interacting with key proteins in cardiomyocytes such as RYR1, RYR2, ATP2A2 and F1-ATPase. S100A1 Protein, Human (C-His) is the recombinant human-derived S100A1 protein, expressed by E. coli , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

S100A1 is a small calcium-binding protein that plays critical roles in multiple processes, including Ca(2+) homeostasis and cardiomyocyte regulation. Elevated intracellular Ca(2+) triggers conformational changes in S100A1, thereby interacting with key proteins in cardiomyocytes such as RYR1, RYR2, ATP2A2 and F1-ATPase. S100A1 Protein, Human (C-His) is the recombinant human-derived S100A1 protein, expressed by E. coli , with C-6*His labeled tag.

Background

S100A1 is a small calcium-binding protein that plays crucial roles in various biological processes, including Ca(2+) homeostasis, chondrocyte biology, and cardiomyocyte regulation. Upon an increase in intracellular Ca(2+) levels, S100A1 binds calcium, triggering conformational changes that facilitate interactions with specific target proteins, subsequently modulating their activity. Particularly, in cardiomyocytes, S100A1 orchestrates a network governing sarcoplasmic reticulum Ca(2+) cycling and mitochondrial function by interacting with key proteins such as ryanodine receptors RYR1 and RYR2, sarcoplasmic reticulum Ca(2+)-ATPase/ATP2A2, and mitochondrial F1-ATPase. This multifaceted protein also contributes to diastolic Ca(2+) dissociation and myofilament mechanics, enhancing relaxation during diastole. S100A1 exists as a dimer of either two alpha chains, two beta chains, or one of each, and it forms heterodimers with S100P. Additionally, it engages in various interactions with proteins like AGER, CAPZA1, FKBP4, RYR1, RYR2, CACYBP, PPP5C, ATP2A2, PLN, ATP5F1A, and ATP5F1B, participating in diverse cellular processes in a calcium-dependent manner.

Verified Bioactivity

Immobilized Human S100A1 at 1 μg/mL (100 μL/well) on the plate can bind Biotinylated Human HSP70. The ED50 for this effect is 2.001 μg/mL.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • S100A1 (M1-S94)
      Accession # P23297
    • 6*His
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    S100A1; Protein S100-A1; Prev. S100A; S100 Calcium-Binding Protein; S100-Alpha; Protein S100; S100 Calcium-Binding Protein A1; S100 Alpha; S-100 Protein Subunit Alpha; S100; S-100 Protein Alpha Chain; S100 Calcium Binding Protein A1; S100 Protein, Alpha P

  • AA Sequence

    MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS

  • Predicted Molecular Mass

    11.4 kDa

  • Molecular Weight

    Approximately 10 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.8.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00